Lus10009420 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09620 215 / 4e-71 Mitochondrial transcription termination factor family protein (.1)
AT2G44020 46 / 7e-06 Mitochondrial transcription termination factor family protein (.1)
AT4G02990 43 / 8e-05 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028701 391 / 9e-141 AT4G09620 226 / 1e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10004614 48 / 2e-06 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10022321 45 / 3e-05 AT4G02990 540 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10014877 44 / 3e-05 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10004534 43 / 6e-05 AT2G44020 477 / 7e-168 Mitochondrial transcription termination factor family protein (.1)
Lus10029422 42 / 0.0001 AT2G36000 294 / 3e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10004219 42 / 0.0002 AT2G36000 293 / 8e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10042322 41 / 0.0005 AT2G21710 720 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G113500 253 / 3e-86 AT4G09620 244 / 1e-82 Mitochondrial transcription termination factor family protein (.1)
Potri.013G116700 50 / 5e-07 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.014G137400 49 / 1e-06 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Potri.009G116200 43 / 8e-05 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Potri.004G209400 40 / 0.0006 AT4G38160 481 / 3e-172 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10009420 pacid=23149723 polypeptide=Lus10009420 locus=Lus10009420.g ID=Lus10009420.BGIv1.0 annot-version=v1.0
ATGGTGGCAGGGATGGTAGGAAGAGCATTGGCTGCAGCACCTCTGCTAACATTCAATTCCAGAACTCGTTCGAGCTTTCTCGATCACGAAATTCAAACAA
CTACACCTCTCGTTCTAAGACCGAACCGGAATCATCCCAACAGATGGGCGGTAGATTCGACTGCAAAGTCCGAAGCTTTACCCTTTACCGACCAAGATCA
GACAACATGGGACTCGTGCAGAGATGTCCTGTCAGCATTCGACTTCGACACCAACGAGAAGGACAAGATGTTGGGGAAAGCATTCGGCCACGTAGCATCC
TCCTATTGGGGCGAAGACCGGAAGCAAGAAGTCCCTACATACGACATCGTTAAAGGGATCGTGGACTACCTGAAACAGCTTGGCTTGACCGACGAGGATC
TGGTCAAGGTGCTGAAGAAGTTTCCGGAAGTCATGGGGTGTAGCCTCGAAGAGGATCTGAAGAAGAACGTTGGGATTCTCGAAAAGGAGTGGGGGATCAA
AGGGAAGACTCTGAGAAGCTTGCTGCTTCGGAATCCGAAGGTTTTGGGGTTCAATGTCGATTGCAAGGGCGATTGTATGGCGCAATGCACTCGCTGCTGG
GTTCGTTTCTGA
AA sequence
>Lus10009420 pacid=23149723 polypeptide=Lus10009420 locus=Lus10009420.g ID=Lus10009420.BGIv1.0 annot-version=v1.0
MVAGMVGRALAAAPLLTFNSRTRSSFLDHEIQTTTPLVLRPNRNHPNRWAVDSTAKSEALPFTDQDQTTWDSCRDVLSAFDFDTNEKDKMLGKAFGHVAS
SYWGEDRKQEVPTYDIVKGIVDYLKQLGLTDEDLVKVLKKFPEVMGCSLEEDLKKNVGILEKEWGIKGKTLRSLLLRNPKVLGFNVDCKGDCMAQCTRCW
VRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G09620 Mitochondrial transcription te... Lus10009420 0 1
AT1G29530 unknown protein Lus10015254 1.4 0.8618
AT5G24460 unknown protein Lus10032931 2.0 0.8540
AT3G16190 Isochorismatase family protein... Lus10006833 3.0 0.8465
AT3G25530 GR1, GLYR1, GHB... glyoxylate reductase 1 (.1.2) Lus10012301 5.3 0.8195
AT3G12350 F-box family protein (.1.2) Lus10010607 5.5 0.8035
AT4G23330 unknown protein Lus10032266 6.9 0.7998
AT1G64850 Calcium-binding EF hand family... Lus10013613 8.5 0.8102
AT1G10500 ATCPISCA chloroplast-localized ISCA-lik... Lus10012683 11.0 0.8122
AT1G76570 Chlorophyll A-B binding family... Lus10005421 12.2 0.7779
AT1G78380 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. ... Lus10042470 12.2 0.8208

Lus10009420 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.