Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006075 [exp] 109 / 2e-33 ND / Lus10000028 [exp] 109 / 2e-33 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G082300 [exp] 62 / 4e-14 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009439 pacid=23149733 polypeptide=Lus10009439 locus=Lus10009439.g ID=Lus10009439.BGIv1.0 annot-version=v1.0 ATGCATAACAGAAAGAGGAAGAAGATAGTCGCAGAACCCACATGGGAAGAGAAGAAGGCCATTGCAGATGAGGAAGAGAAGTCATTGCACAGTGAGATTC GAGATCCTCGAACATGGATTGGTATGGTGGATGGAATGAACGATGGGGAGTTGATGGAGTACTTGATGAACAGGCCTAAGGAGCTGAAGAGTGTCAAGAT TCAGAAGATGAGGAAGCAAACTTAA
AA sequence Show only first row Show all	>Lus10009439 pacid=23149733 polypeptide=Lus10009439 locus=Lus10009439.g ID=Lus10009439.BGIv1.0 annot-version=v1.0 MHNRKRKKIVAEPTWEEKKAIADEEEKSLHSEIRDPRTWIGMVDGMNDGELMEYLMNRPKELKSVKIQKMRKQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009439 [exp]	0	1
AT2G43610			Chitinase family protein (.1)		Lus10001772 [exp]	5.1	0.9773
AT3G52080		CHX28	cation/hydrogen exchanger 28 (...		Lus10019716 [exp]	6.0	0.9375
AT1G02335		GL22	germin-like protein subfamily ...		Lus10020632 [exp]	8.4	0.9698
					Lus10038463 [exp]	10.8	0.9664
AT3G03080			Zinc-binding dehydrogenase fam...		Lus10003638 [exp]	11.3	0.9661
AT5G38195			Bifunctional inhibitor/lipid-t...		Lus10017615 [exp]	11.7	0.9276
AT5G18410		ATSRA1, KLK, PI...	PIROGI 121, PIROGI, KLUNKER, t...		Lus10003109 [exp]	11.7	0.9014
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Lus10029016 [exp]	13.4	0.9641
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10028844 [exp]	14.3	0.9642
					Lus10009618 [exp]	16.9	0.9639

Compare expression of checked genes

Lus10009439 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.