Lus10009449 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10009449 pacid=23149688 polypeptide=Lus10009449 locus=Lus10009449.g ID=Lus10009449.BGIv1.0 annot-version=v1.0
ATGGGCGGCGGCTATGAAGACATCAAGTTCCTCAAGGCCGAATCCGAGAGGATAAAGGCTGAATGCGAGTTCCTGAAGGCCGAATGTGAGTTCCTGAAAG
CCGAATCTGAGAAGATAAAGGCCGAATGTGAGTCCCTAAAGGCTGACCCCGCGAAGATGACAGCTGAATTCAAGAAGACGAGAGCCAGAGTCAAGAAGAC
AACAGCCAAATTGGAGTCCCTGGCGGCCGAATCCCTGAAGGCCGAATCCGCGAAGATAAAGGCCGAATTTGAGAAGATGATCAAGGCTGAATTCAAGAAG
ATGAGAGGCGACGTCTCGAAGCTGAAGTCCGAGCTCGATCTCTCATCCGGTGTCATTATCGTTCTTGTACTCTTCGTTGCTGCTCTCTTCGTTGTCTTGG
TGATCTGTCAAATTGCATCCCGATGA
AA sequence
>Lus10009449 pacid=23149688 polypeptide=Lus10009449 locus=Lus10009449.g ID=Lus10009449.BGIv1.0 annot-version=v1.0
MGGGYEDIKFLKAESERIKAECEFLKAECEFLKAESEKIKAECESLKADPAKMTAEFKKTRARVKKTTAKLESLAAESLKAESAKIKAEFEKMIKAEFKK
MRGDVSKLKSELDLSSGVIIVLVLFVAALFVVLVICQIASR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10009449 0 1
AT5G51330 DYAD, SWI1 SWITCH1 (.1) Lus10009021 3.5 0.8009
AT3G60630 GRAS ATHAM2, LOM2 LOST MERISTEMS 2, ARABIDOPSIS ... Lus10012237 4.7 0.6496
AT1G13710 CYP78A5, KLUH KLUH, "cytochrome P450, family... Lus10015788 5.5 0.7732
AT1G61290 ATSYP124, SYP12... syntaxin of plants 124 (.1) Lus10018441 6.7 0.7408
Lus10005187 11.3 0.6541
Lus10010117 12.6 0.6541
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025408 13.9 0.6541
Lus10002152 15.0 0.6541
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10040338 16.0 0.6541
AT2G25010 Aminotransferase-like, plant m... Lus10008761 17.0 0.6541

Lus10009449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.