Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25950 102 / 8e-30 VATG3 vacuolar ATP synthase G3 (.1) AT3G01390 75 / 8e-19 AVMA10, VMA10 vacuolar membrane ATPase 10 (.1.2) AT4G23710 72 / 8e-18 VAG2 ,VATG2 ,VHA-G2 vacuolar ATP synthase subunit G2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001543 [exp] 182 / 2e-61 AT4G25950 123 / 8e-38 vacuolar ATP synthase G3 (.1) Lus10029418 [exp] 99 / 3e-28 AT3G01390 143 / 7e-46 vacuolar membrane ATPase 10 (.1.2) Lus10004213 [exp] 99 / 4e-28 AT3G01390 143 / 9e-46 vacuolar membrane ATPase 10 (.1.2) Lus10016977 [exp] 99 / 5e-28 AT3G01390 129 / 4e-40 vacuolar membrane ATPase 10 (.1.2) Lus10021301 [exp] 95 / 1e-26 AT4G23710 123 / 1e-37 vacuolar ATP synthase subunit G2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G080700 [exp] 106 / 4e-31 AT4G25950 120 / 8e-37 vacuolar ATP synthase G3 (.1) Potri.010G222000 [exp] 92 / 3e-25 AT3G01390 147 / 2e-47 vacuolar membrane ATPase 10 (.1.2) Potri.008G040300 [exp] 89 / 2e-24 AT3G01390 145 / 2e-46 vacuolar membrane ATPase 10 (.1.2) Potri.013G108300 [exp] 76 / 3e-19 AT3G01390 64 / 2e-14 vacuolar membrane ATPase 10 (.1.2) Potri.019G133701 [exp] 46 / 7e-08 AT4G25950 74 / 1e-18 vacuolar ATP synthase G3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0255 [flax] [poplar] ATP_synthase PF03179 [flax] [poplar] V-ATPase_G Vacuolar (H+)-ATPase G subunit
Representative CDS sequence Show only first row Show all	>Lus10009452 pacid=23149725 polypeptide=Lus10009452 locus=Lus10009452.g ID=Lus10009452.BGIv1.0 annot-version=v1.0 ATGGATCCAATGAGAAGCCAAGGAGCCATTCAAATGCTGCTCTCTGCAGAGCAGGAGGCACAACAGATCGTGGCCGCGGCCAGAAATCTGAAATTGTCGA GGTTAAAGCAGGCGAAGGACGAAGCGGAGAAGGAGGCAGTGAGGTACCGTTCGCAGTTGCAGGCCGAGTTCCAGAAGAAAATATCCGAGGGGAATCCGGC TGCGACTGCGAAACAACTGGATGAGGACACAATGAAGAGGATTGAGAAGCTTAAGGAATCATCTTCTAAGGTGCAGACAGAGTTGGTTGACATGCTTGTT AAGTTTGTTACAACGGTGAAGAACTAG
AA sequence Show only first row Show all	>Lus10009452 pacid=23149725 polypeptide=Lus10009452 locus=Lus10009452.g ID=Lus10009452.BGIv1.0 annot-version=v1.0 MDPMRSQGAIQMLLSAEQEAQQIVAAARNLKLSRLKQAKDEAEKEAVRYRSQLQAEFQKKISEGNPAATAKQLDEDTMKRIEKLKESSSKVQTELVDMLV KFVTTVKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Lus10009452 [exp]	0	1
AT5G25180		CYP71B14	"cytochrome P450, family 71, s...		Lus10024331 [exp]	1.0	0.9531
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023036 [exp]	4.2	0.8222
AT1G06340			Plant Tudor-like protein (.1)		Lus10039027 [exp]	5.2	0.8222
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10018718 [exp]	6.0	0.8222
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10026169 [exp]	6.7	0.8222
AT2G44220			Protein of Unknown Function (D...		Lus10006862 [exp]	7.3	0.8222
AT4G26466		LRE	lorelei (.1)		Lus10011066 [exp]	8.4	0.7499
AT5G28823			unknown protein		Lus10040056 [exp]	9.0	0.7038
AT3G60680			Plant protein of unknown funct...		Lus10034935 [exp]	11.0	0.6727
					Lus10025786 [exp]	11.5	0.6595

Compare expression of checked genes

Lus10009452 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.