Lus10009459 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22610 493 / 1e-168 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT3G57880 429 / 2e-146 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
AT5G12970 427 / 4e-146 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
AT1G51570 426 / 1e-145 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
AT5G06850 407 / 8e-138 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT4G11610 412 / 2e-137 NTRB, ATNTRB C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT5G48060 391 / 3e-129 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT4G00700 360 / 9e-118 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT3G61300 354 / 2e-115 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
AT1G74720 332 / 3e-106 QKY QUIRKY, C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001538 546 / 0 AT1G22610 1425 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10012026 433 / 7e-148 AT3G57880 1496 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Lus10016280 432 / 1e-147 AT3G57880 1499 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Lus10023823 420 / 8e-143 AT5G06850 1382 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10021030 418 / 6e-142 AT5G06850 1383 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10037479 407 / 6e-141 AT5G48060 866 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10000605 415 / 1e-138 AT4G11610 1634 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10018839 400 / 9e-133 AT4G11610 1348 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Lus10000164 311 / 1e-106 AT1G04150 425 / 7e-142 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G107700 491 / 5e-168 AT1G22610 1414 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.019G080000 491 / 7e-168 AT1G22610 1442 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.016G049100 424 / 8e-145 AT3G57880 1425 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Potri.006G058700 419 / 2e-142 AT5G06850 1321 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.006G058900 418 / 2e-142 AT3G57880 1372 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1)
Potri.016G049300 416 / 3e-141 AT5G06850 1355 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.001G105400 420 / 1e-140 AT4G11610 1567 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.003G125900 420 / 1e-140 AT4G11610 1543 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.009G065600 414 / 3e-140 AT5G06850 1308 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Potri.001G271400 419 / 7e-140 AT5G48060 1481 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0484 Peroxisome PF08372 PRT_C Plant phosphoribosyltransferase C-terminal
Representative CDS sequence
>Lus10009459 pacid=23149729 polypeptide=Lus10009459 locus=Lus10009459.g ID=Lus10009459.BGIv1.0 annot-version=v1.0
ATGGTGGCACAATACAGCAGACCATTACTCCCCAAGATGCATTATGCACATCCAATCCCCGTTCGTCACATCGACTGGCTAAGACACCAAGCTATGCAGA
TCGTCGCTACAAGACTCGCCAGAGCAGAACCGCCCTTGAGACGAGAAGTGGTCGAGTACATGTTGGACGTTGATTACCATATGTGGAGTTTACGACGAAG
CAAAGCGAACTTCCATCGTATAATGTCGGTATTATCAACCGTAACAGGAGCTTTCAAGTGGTTCAACGAAATCTGTTACTGGAGAAACCCGATAACGACA
TGTTTGGTTCATATCCTGTTCTTGATCCTTGTTTGCTACCCTGAACTTGTCCTGCCTACTGTCTTTCTGTACTTATTCGTGATCGGGTTATGGAACTACC
GGTTTCGTCCCAGGCATCCTCCGCATATGGACATAAGGCTGTCACAAGCGGAACATGTTCATCCGGACGAGCTGGATGAAGAATTCGATTCGTTTCCAAC
TTCTAGACCGGCGGATATTGTGAGGATGAGGTATGACAGGCTGAGGAGTGTTGCAGGGAGGGTTCAGACTGTGATTGGGGATCTTGCGAGCCAGGGGGAG
AGAGCTCACGCCATACTAAGTTGGAGAGATCCGAGGGCTACTGCGATCTTTATCGTGTTTGCGCTTGTTTCTGCTGTGTTTATCTATGTCACGCCGTTCC
AGGTTGTGGCGGTTCTTGTTGGTGTATTCATGCTTCGACATCCCAGGTTCCGGAGCCGGATGCCTTCTGTCCCAGTCAACTTCTTCAAGAGATTGCCCGC
GAAATCCGATCTGTTGCTATGA
AA sequence
>Lus10009459 pacid=23149729 polypeptide=Lus10009459 locus=Lus10009459.g ID=Lus10009459.BGIv1.0 annot-version=v1.0
MVAQYSRPLLPKMHYAHPIPVRHIDWLRHQAMQIVATRLARAEPPLRREVVEYMLDVDYHMWSLRRSKANFHRIMSVLSTVTGAFKWFNEICYWRNPITT
CLVHILFLILVCYPELVLPTVFLYLFVIGLWNYRFRPRHPPHMDIRLSQAEHVHPDELDEEFDSFPTSRPADIVRMRYDRLRSVAGRVQTVIGDLASQGE
RAHAILSWRDPRATAIFIVFALVSAVFIYVTPFQVVAVLVGVFMLRHPRFRSRMPSVPVNFFKRLPAKSDLLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G22610 C2 calcium/lipid-binding plant... Lus10009459 0 1
AT3G12920 BRG3 BOI-related gene 3, SBP (S-rib... Lus10031780 2.0 0.9437
AT2G20780 AtPLT4 Major facilitator superfamily ... Lus10031637 2.8 0.9490
AT4G27350 Protein of unknown function (D... Lus10038565 3.5 0.9507
AT1G65730 YSL7 YELLOW STRIPE like 7 (.1) Lus10043408 3.9 0.9180
AT5G15740 RRT1 O-fucosyltransferase family pr... Lus10034651 4.5 0.9224
AT3G62470 Pentatricopeptide repeat (PPR)... Lus10003461 4.9 0.9268
AT2G29550 TUB7 tubulin beta-7 chain (.1) Lus10038458 5.7 0.9484
AT3G51990 Protein kinase superfamily pro... Lus10019753 5.7 0.9012
AT5G03110 unknown protein Lus10026490 5.7 0.9238
AT2G33850 unknown protein Lus10018650 7.7 0.9099

Lus10009459 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.