Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47840 50 / 5e-09 AMK2 adenosine monophosphate kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003504 [exp] 74 / 3e-18 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1) Lus10037995 [exp] 45 / 3e-07 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G103400 [exp] 49 / 8e-09 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1) Potri.019G078200 [exp] 49 / 1e-08 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009477 pacid=23149718 polypeptide=Lus10009477 locus=Lus10009477.g ID=Lus10009477.BGIv1.0 annot-version=v1.0 ATGTACGAGAATATTACTCTGAAGGTATGCTATGCCGCCATTACTTTGAAGATCAAAGGGAATGTCTCGAAAGAAGAGGTCTTTGCCCAGATCGACAACA CCCTGTCAAAATTGCTCGAGAGTCGAAAGGCAGCATCTCCGGAATCTCAGGCTGCTTGA
AA sequence Show only first row Show all	>Lus10009477 pacid=23149718 polypeptide=Lus10009477 locus=Lus10009477.g ID=Lus10009477.BGIv1.0 annot-version=v1.0 MYENITLKVCYAAITLKIKGNVSKEEVFAQIDNTLSKLLESRKAASPESQAA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47840		AMK2	adenosine monophosphate kinase...		Lus10009477 [exp]	0	1
AT2G30530			unknown protein		Lus10034444 [exp]	1.0	0.8740
AT4G26240			unknown protein		Lus10012919 [exp]	2.0	0.8330
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10043009 [exp]	2.8	0.8239
AT5G48630			Cyclin family protein (.1.2)		Lus10002354 [exp]	5.0	0.8325
AT3G27970			Exonuclease family protein (.1...		Lus10022230 [exp]	6.3	0.7913
AT3G56250			unknown protein		Lus10030552 [exp]	9.5	0.7710
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10018672 [exp]	9.8	0.8310
AT5G65880			unknown protein		Lus10011719 [exp]	9.9	0.8426
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Lus10026038 [exp]	10.1	0.8735
					Lus10006458 [exp]	11.5	0.7712

Compare expression of checked genes

Lus10009477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.