Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47840 291 / 5e-101 AMK2 adenosine monophosphate kinase (.1) AT5G35170 222 / 4e-70 adenylate kinase family protein (.1.2) AT5G63400 117 / 2e-33 ADK1 adenylate kinase 1 (.1.2) AT5G50370 113 / 3e-31 Adenylate kinase family protein (.1) AT4G25280 96 / 2e-24 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G26667 94 / 2e-24 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) AT2G37250 94 / 9e-24 ADK, ATPADK1 adenosine kinase (.1) AT3G60180 85 / 8e-21 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT2G39270 83 / 2e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT3G01820 57 / 6e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037995 [exp] 298 / 5e-105 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1) Lus10003504 [exp] 263 / 7e-90 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1) Lus10009228 [exp] 258 / 6e-88 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1) Lus10036326 [exp] 215 / 2e-68 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2) Lus10019071 [exp] 172 / 8e-51 AT5G35170 720 / 0.0 adenylate kinase family protein (.1.2) Lus10016757 [exp] 121 / 2e-34 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2) Lus10022453 [exp] 118 / 3e-33 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2) Lus10031135 [exp] 89 / 4e-22 AT4G25280 263 / 3e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10031611 [exp] 89 / 4e-22 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G103400 [exp] 310 / 5e-108 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1) Potri.019G078200 [exp] 300 / 5e-104 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1) Potri.018G113400 [exp] 213 / 1e-66 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2) Potri.006G189201 [exp] 120 / 9e-36 AT5G35170 158 / 1e-46 adenylate kinase family protein (.1.2) Potri.012G095300 [exp] 116 / 1e-32 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2) Potri.015G092800 [exp] 114 / 6e-32 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2) Potri.015G129000 [exp] 94 / 6e-24 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.014G043300 [exp] 90 / 8e-23 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Potri.014G104700 [exp] 90 / 9e-23 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3) Potri.002G134600 [exp] 89 / 2e-22 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00406 [flax] [poplar] ADK Adenylate kinase CL0023 [flax] [poplar] PF05191 [flax] [poplar] ADK_lid Adenylate kinase, active site lid
Representative CDS sequence Show only first row Show all	>Lus10009478 pacid=23149735 polypeptide=Lus10009478 locus=Lus10009478.g ID=Lus10009478.BGIv1.0 annot-version=v1.0 ATGATTTCCGGTGCTCCGGCGTCTGGTAAAGGTACTCAATGTGAGCTGATTACTAAAAAGTATGACTTGGTGCACATTGCTGCTGGAGACTTGCTGCGAG AAGAGATTGCTTCAGGGAGCGAGAATGGGAAGCGAGCCAAGGAATACATGGAGAAAGGACAGTTGGTTCCTAATGAAATAGTTGTGATGATGGTGAAAGA CCGGCTGATGCAGCCGGACTCGCAAGAAAAAGGATGGCTATTAGATGGATACCCTCGGAGCATGTCTCAAGCAACTGCTCTCAAAGAATACGGCTTTCAG CCTGATATTTTCATCGTCTTGGAAGTCCCGGAAGATATCCTTGTGGAAAGAGTTGTTGGACGCAGACTGGACCCCGTTACTGGCAAGATCTACCACTTGA CTTACTCCCCACCCGAGACTGAAGAGATAGCTGCCAGGCTCACTCAACGTTTCGACGATACTGAAGAGAAGGCATGTCTCTATTATCTGAGACCATAA
AA sequence Show only first row Show all	>Lus10009478 pacid=23149735 polypeptide=Lus10009478 locus=Lus10009478.g ID=Lus10009478.BGIv1.0 annot-version=v1.0 MISGAPASGKGTQCELITKKYDLVHIAAGDLLREEIASGSENGKRAKEYMEKGQLVPNEIVVMMVKDRLMQPDSQEKGWLLDGYPRSMSQATALKEYGFQ PDIFIVLEVPEDILVERVVGRRLDPVTGKIYHLTYSPPETEEIAARLTQRFDDTEEKACLYYLRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47840		AMK2	adenosine monophosphate kinase...		Lus10009478 [exp]	0	1
AT4G22756		ATSMO1-2, ATSMO...	sterol C4-methyl oxidase 1-2 (...		Lus10004324 [exp]	17.1	0.8741
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Lus10019086 [exp]	24.5	0.8679
AT2G28610	HD	PRS1, PRS, WOX3	WUSCHEL RELATED HOMEOBOX 3, PR...		Lus10023332 [exp]	47.2	0.8555
					Lus10036535 [exp]	80.0	0.8509
AT4G35160			O-methyltransferase family pro...		Lus10001510 [exp]	95.0	0.7687
AT4G20160			unknown protein		Lus10036249 [exp]	132.7	0.7938
AT2G45970		CYP86A8, LCR	LACERATA, "cytochrome P450, fa...		Lus10017789 [exp]	171.3	0.7967
AT1G03170		FAF2	FANTASTIC FOUR 2, Protein of u...		Lus10014665 [exp]	179.8	0.8339
AT4G37320		CYP81D5	"cytochrome P450, family 81, s...		Lus10024819 [exp]	188.4	0.8384
AT3G19620			Glycosyl hydrolase family prot...		Lus10002128 [exp]	203.9	0.8390

Compare expression of checked genes

Lus10009478 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.