Lus10009482 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33970 148 / 8e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
AT4G09950 135 / 7e-38 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33900 117 / 3e-31 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33870 109 / 6e-29 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33960 105 / 1e-26 AIG1 AVRRPT2-INDUCED GENE 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33930 105 / 1e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G26820 105 / 6e-26 ATPP2-A3 phloem protein 2-A3 (.1)
AT1G33830 100 / 2e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33950 100 / 7e-25 Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2)
AT1G33910 100 / 7e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005299 197 / 4e-61 AT1G33970 339 / 5e-115 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10005300 180 / 3e-54 AT1G33970 321 / 7e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10026891 115 / 2e-31 AT2G26820 156 / 2e-45 phloem protein 2-A3 (.1)
Lus10003732 117 / 8e-31 AT1G33970 210 / 1e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10005301 111 / 9e-31 AT1G33970 121 / 3e-34 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10009484 97 / 6e-23 AT4G26220 255 / 1e-83 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10003507 88 / 2e-22 AT1G33930 82 / 3e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10028023 59 / 3e-10 AT4G09940 181 / 2e-55 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G104800 186 / 2e-57 AT1G33970 314 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Potri.019G077300 176 / 9e-54 AT1G33970 345 / 2e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF04548 AIG1 AIG1 family
Representative CDS sequence
>Lus10009482 pacid=23149744 polypeptide=Lus10009482 locus=Lus10009482.g ID=Lus10009482.BGIv1.0 annot-version=v1.0
ATGGCGAGAAATGGGATTGATGCTATCATTCTCGTCTCATCAGTGGGGAATCCCTTCACTGAAGAGGAACAATCTGCCATTCGCAATTTCCAGTCTTTGT
TTGGAGCAAAGATAATAGGATACATGATTGTAGTCTTCACTGATGGGGATCGACTTGGGGATCATCTTACTTTAGACGACTATCTGGGACATGGGGCTGT
CCTTGCCCTCCTAAAGGAAGTTCTAGAGCGTTGTGAGAATCGGATGGTCCTATTCGATAACCAGACCAAAGATGAAGTCAACAGAATTCAACAGGTTAAC
CAGCTTATGAAGCTGGTCGACAATGTTGTTCAGAAGAATAATGGATTACCTTACACAAATTACTTATTCATTGAGATGCAGAAACAGGCAGCAATCATGC
GCGATAAACAGCTCATGCTCAATTCCTTGACCTCAAAGTCTGCTGCTAATCTGGAACTGATCCATTTGAAAGAAGAAATGAACAAGAAATCTGAAGAACA
ACTTAAACTTATCACTGAGACGTTTGGTGTGAAGCTGAATGAGGGGACTGCTGAGCTGAAGAAGCAGGTAGAAGCAGAGCAAGCAGTACGTTGTATGGCA
GAGGAAGCTTTGAAATCGAGCGATGAAATTTGCAAGCTACGAAAGGATATAGGGAAAGCTCAGACTCTGGCTAGCGAGATAGAGGAGCTGAGGAAGCAAC
TGACTGCAAAGGGTTCCTGTTCAATGCACATTATTTTGTGA
AA sequence
>Lus10009482 pacid=23149744 polypeptide=Lus10009482 locus=Lus10009482.g ID=Lus10009482.BGIv1.0 annot-version=v1.0
MARNGIDAIILVSSVGNPFTEEEQSAIRNFQSLFGAKIIGYMIVVFTDGDRLGDHLTLDDYLGHGAVLALLKEVLERCENRMVLFDNQTKDEVNRIQQVN
QLMKLVDNVVQKNNGLPYTNYLFIEMQKQAAIMRDKQLMLNSLTSKSAANLELIHLKEEMNKKSEEQLKLITETFGVKLNEGTAELKKQVEAEQAVRCMA
EEALKSSDEICKLRKDIGKAQTLASEIEELRKQLTAKGSCSMHIIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G33970 P-loop containing nucleoside t... Lus10009482 0 1
AT3G47570 Leucine-rich repeat protein ki... Lus10004827 2.0 0.8846
AT4G38620 MYB AtMYB4 myb domain protein 4 (.1) Lus10041888 2.0 0.8920
AT5G10140 MADS FLF, AGL25, FLC FLOWERING LOCUS F, FLOWERING L... Lus10015766 2.4 0.8597
AT5G06440 unknown protein Lus10016186 3.0 0.8729
AT5G36930 Disease resistance protein (TI... Lus10026961 3.9 0.8622
AT1G54870 NAD(P)-binding Rossmann-fold s... Lus10033745 5.7 0.8683
AT3G02100 UDP-Glycosyltransferase superf... Lus10003454 7.7 0.8319
AT4G14750 IQD19 IQ-domain 19 (.1) Lus10015930 8.5 0.8324
AT3G26880 Plant self-incompatibility pro... Lus10025937 11.6 0.8531
AT3G27050 unknown protein Lus10032042 15.8 0.8304

Lus10009482 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.