Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G33970 90 / 7e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) AT4G09940 82 / 2e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33930 79 / 1e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33950 74 / 7e-17 Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2) AT4G09950 73 / 2e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G26820 73 / 4e-16 ATPP2-A3 phloem protein 2-A3 (.1) AT1G33890 70 / 3e-15 Avirulence induced gene (AIG1) family protein (.1) AT4G09930 68 / 2e-14 Avirulence induced gene (AIG1) family protein (.1) AT1G33960 67 / 3e-14 AIG1 AVRRPT2-INDUCED GENE 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33830 64 / 1e-13 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005300 [exp] 107 / 1e-28 AT1G33970 321 / 7e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10028023 [exp] 91 / 1e-23 AT4G09940 181 / 2e-55 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10003732 [exp] 92 / 2e-23 AT1G33970 210 / 1e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10005299 [exp] 92 / 3e-23 AT1G33970 339 / 5e-115 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10009485 [exp] 87 / 9e-23 AT1G33970 142 / 2e-42 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10026891 [exp] 78 / 8e-19 AT2G26820 156 / 2e-45 phloem protein 2-A3 (.1) Lus10027366 [exp] 45 / 3e-06 AT2G40720 328 / 7e-101 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G077300 [exp] 105 / 2e-28 AT1G33970 345 / 2e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Potri.013G104800 [exp] 95 / 1e-24 AT1G33970 314 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Potri.008G224900 [exp] 40 / 0.0002 AT4G02510 847 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF04548 [flax] [poplar] AIG1 AIG1 family
Representative CDS sequence Show only first row Show all	>Lus10009483 pacid=23149734 polypeptide=Lus10009483 locus=Lus10009483.g ID=Lus10009483.BGIv1.0 annot-version=v1.0 ATGGAAGCTCCCGGCGTCTGTCCCGCATTTACTGGACTGCGAGATGTCGAGAAAGGGACGAAGCTAGACGGAAGAATCCACTTGATTGGAGAAGTTCGGA TCTTCACTGCAGATGAGTTGGAGTTCACTACTCCATACAGTGGTGATAGAACCATCGTTCTATTTGGACGAACTGGCAACGGAAAGAGCGCGACTGGAAA CAGCATTCTAGGGAGAAAGGCTTTCTATTTGATGATGAGTCTATCAGGTGTCACAACTAGCTGCAAAGTGCACAGACCTCTTATGGAAGATGGTCAAATC GTCAATGTCATTGATACACCTGGTATATGA
AA sequence Show only first row Show all	>Lus10009483 pacid=23149734 polypeptide=Lus10009483 locus=Lus10009483.g ID=Lus10009483.BGIv1.0 annot-version=v1.0 MEAPGVCPAFTGLRDVEKGTKLDGRIHLIGEVRIFTADELEFTTPYSGDRTIVLFGRTGNGKSATGNSILGRKAFYLMMSLSGVTTSCKVHRPLMEDGQI VNVIDTPGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G33970			P-loop containing nucleoside t...		Lus10009483 [exp]	0	1
AT1G04010		ATPSAT1	phospholipid sterol acyl trans...		Lus10024927 [exp]	15.2	0.7121
AT5G44740		POLH	Y-family DNA polymerase H (.1....		Lus10038376 [exp]	21.0	0.6439
AT3G02065			P-loop containing nucleoside t...		Lus10006736 [exp]	32.2	0.6803
					Lus10016250 [exp]	39.4	0.6132
AT2G31690			alpha/beta-Hydrolases superfam...		Lus10026735 [exp]	71.0	0.6389

Compare expression of checked genes

Lus10009483 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.