Lus10009485 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G33970 143 / 2e-42 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
AT1G33930 122 / 3e-34 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33950 116 / 3e-32 Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2)
AT4G09940 115 / 4e-31 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33960 107 / 1e-28 AIG1 AVRRPT2-INDUCED GENE 1, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT1G33900 106 / 2e-28 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT2G26820 105 / 3e-27 ATPP2-A3 phloem protein 2-A3 (.1)
AT4G09950 101 / 3e-26 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT4G09930 96 / 3e-24 Avirulence induced gene (AIG1) family protein (.1)
AT1G33890 94 / 2e-23 Avirulence induced gene (AIG1) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028023 203 / 1e-66 AT4G09940 181 / 2e-55 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10003732 162 / 9e-50 AT1G33970 210 / 1e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10005300 162 / 4e-49 AT1G33970 321 / 7e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10005299 147 / 4e-43 AT1G33970 339 / 5e-115 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10026891 98 / 8e-26 AT2G26820 156 / 2e-45 phloem protein 2-A3 (.1)
Lus10009483 87 / 1e-22 AT1G33970 91 / 3e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Lus10029198 58 / 1e-11 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Lus10025909 55 / 2e-10 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1)
Lus10008991 51 / 5e-09 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G077300 167 / 7e-52 AT1G33970 345 / 2e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Potri.013G104800 165 / 5e-51 AT1G33970 314 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
Potri.004G171600 42 / 7e-05 AT3G16620 1128 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1)
Potri.009G131200 42 / 8e-05 AT3G16620 1129 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1)
Potri.002G183400 40 / 0.0002 AT1G02280 417 / 6e-148 PLASTID PROTEIN IMPORT 1, translocon at the outer envelope membrane of chloroplasts 33 (.1.2)
Potri.008G225000 40 / 0.0004 AT4G02510 790 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF04548 AIG1 AIG1 family
Representative CDS sequence
>Lus10009485 pacid=23149695 polypeptide=Lus10009485 locus=Lus10009485.g ID=Lus10009485.BGIv1.0 annot-version=v1.0
ATGGCCATTGGATTGCCAAGTAGCCTAGCCAAGCAGATCCTCCGAAGAACTGGCTCCGGATCCTCCTCGAGGTTTCAAGATGTGCCAAAGGGAATGGGAG
GATCTTCCATTGAAAACGACTGGGAGTTAACCGATCCATCTAGCGGGACGGCTCGAACAATTGTACTTATTGGTCGTACTGGTAACGGCAAAAGTGCGAC
TGGCAATACCATTCTGGCGAGAAAAGCTTTCAACTCGAAATTTAGCTCGTTGGGCGTTACGAGTAGCTGTGAATTGCAGACGACTGTTTTGAATGACGGT
CATGTCCTAAATGTCATTGATACTCCAGGACTGTTTGATCCTGCAATGGATTCTGAATTCGTGAGCAAGGAAATTGCAAACTGCATCAAAATGGCATGGG
ACGGGATACATTGTGTGATCGTTGTTTCCTCAGTAAGGAATTGA
AA sequence
>Lus10009485 pacid=23149695 polypeptide=Lus10009485 locus=Lus10009485.g ID=Lus10009485.BGIv1.0 annot-version=v1.0
MAIGLPSSLAKQILRRTGSGSSSRFQDVPKGMGGSSIENDWELTDPSSGTARTIVLIGRTGNGKSATGNTILARKAFNSKFSSLGVTSSCELQTTVLNDG
HVLNVIDTPGLFDPAMDSEFVSKEIANCIKMAWDGIHCVIVVSSVRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G33970 P-loop containing nucleoside t... Lus10009485 0 1
AT5G38435 SPH8 S-protein homologue 8 (.1) Lus10029379 41.4 0.5366
AT4G14465 AT-hook AHL20 AT-hook motif nuclear-localize... Lus10022010 88.3 0.5275
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10006697 127.9 0.4991
AT2G19170 SLP3 subtilisin-like serine proteas... Lus10040146 216.2 0.4679

Lus10009485 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.