Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 37 / 8e-05 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009000 [exp] 63 / 5e-15 AT4G38840 118 / 5e-36 SAUR-like auxin-responsive protein family (.1) Lus10008994 [exp] 64 / 1e-14 AT5G18050 113 / 2e-33 SAUR-like auxin-responsive protein family (.1) Lus10009624 [exp] 59 / 2e-13 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1) Lus10009627 [exp] 58 / 5e-13 AT4G38840 118 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10025910 [exp] 58 / 6e-13 AT4G38840 117 / 9e-36 SAUR-like auxin-responsive protein family (.1) Lus10038191 [exp] 57 / 1e-12 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 57 / 1e-12 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10008996 [exp] 57 / 2e-12 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 57 / 2e-12 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 47 / 2e-08 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 44 / 1e-07 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 44 / 2e-07 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 43 / 3e-07 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 41 / 2e-06 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 37 / 6e-05 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 36 / 0.0001 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 35 / 0.0003 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 35 / 0.0005 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10009486 pacid=23149694 polypeptide=Lus10009486 locus=Lus10009486.g ID=Lus10009486.BGIv1.0 annot-version=v1.0 ATGGCTATTGGATTGCCTGGTAATCTTGCTGCTAAGCAGATCCTCCGAAGAACTTGGTCCGGATCGAGCAGAGGATCCTCTTCAAGGTTTCAAGATGTTC CCAAGGGGTACTTGGCGGTATATGTTGGGGAGACACGCAGAAGAAGAGGTTCGTTGTACCGGCTCCCTACTTGA
AA sequence Show only first row Show all	>Lus10009486 pacid=23149694 polypeptide=Lus10009486 locus=Lus10009486.g ID=Lus10009486.BGIv1.0 annot-version=v1.0 MAIGLPGNLAAKQILRRTWSGSSRGSSSRFQDVPKGYLAVYVGETRRRRGSLYRLPT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009486 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009628 [exp]	1.7	0.9824
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009001 [exp]	2.4	0.9728
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009623 [exp]	3.0	0.9705
AT3G59090			unknown protein		Lus10040880 [exp]	5.7	0.9587
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10003717 [exp]	7.1	0.9555
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008991 [exp]	8.5	0.9548
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10040484 [exp]	8.9	0.9520
AT2G16850		PIP3B, PIP2;8	PLASMA MEMBRANE INTRINSIC PROT...		Lus10039222 [exp]	10.4	0.9345
AT4G12690			Plant protein of unknown funct...		Lus10006223 [exp]	11.2	0.9508
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10006413 [exp]	13.9	0.9379

Compare expression of checked genes

Lus10009486 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.