Lus10009498 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10009498 pacid=23147331 polypeptide=Lus10009498 locus=Lus10009498.g ID=Lus10009498.BGIv1.0 annot-version=v1.0
ATGGTCGTTCCTAAGCCCAAACAAAGGTGGGAAAGTAAGGAGTTTGACTCAAGTGACGATGAACCTAACAGCCAAGGAGCTGATAGAGCCGGGAACCATG
AACAAGTGACGATGAACCTAACAGCCAAGGAGCTCATAGAGCCGACGCTTACTATTAATAAAGGAAAGCATCGGCTTATTTGGTACCCCGCGGATCAGAG
AACTGGCTTGACACAGCAAAAGAAAAGAGGAGAGTTCGATCCCATTCTCCGGGAAGAAGAGATCTTAGTGAACCCCCTTGACCCAAGGCCAAAGGCTGCA
TAG
AA sequence
>Lus10009498 pacid=23147331 polypeptide=Lus10009498 locus=Lus10009498.g ID=Lus10009498.BGIv1.0 annot-version=v1.0
MVVPKPKQRWESKEFDSSDDEPNSQGADRAGNHEQVTMNLTAKELIEPTLTINKGKHRLIWYPADQRTGLTQQKKRGEFDPILREEEILVNPLDPRPKAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10009498 0 1
AT2G07820 unknown protein Lus10015035 1.0 0.9784
Lus10004082 1.4 0.9751
Lus10000297 5.7 0.9371
AT1G64790 ILA ILITYHIA (.1.2) Lus10003102 6.0 0.9658
Lus10001189 6.0 0.9371
AT3G12440 Polynucleotidyl transferase, r... Lus10000103 8.0 0.9587
AT1G64790 ILA ILITYHIA (.1.2) Lus10004767 8.9 0.9497
AT5G11560 catalytics (.1) Lus10022143 12.5 0.9340
AT4G34980 SLP2 subtilisin-like serine proteas... Lus10034495 13.0 0.9170
AT5G28740 Tetratricopeptide repeat (TPR)... Lus10022347 13.4 0.9308

Lus10009498 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.