Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG00180 190 / 3e-58 ATCG00180.1, RPOC1 DNA-directed RNA polymerase family protein (.1) AT4G35800 44 / 6e-06 RNA_POL_II_LSRNA_POL_II_LS, RNA_POL_II_LS, NRPB1 RNA polymerase II large subunit (.1) AT3G57660 42 / 5e-05 NRPA1 nuclear RNA polymerase A1 (.1) AT5G60040 40 / 0.0001 NRPC1 nuclear RNA polymerase C1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041856 [exp] 47 / 6e-07 AT4G35800 2541 / 0.0 RNA polymerase II large subunit (.1) Lus10028403 [exp] 47 / 1e-06 AT4G35800 1076 / 0.0 RNA polymerase II large subunit (.1) Lus10011299 [exp] 45 / 4e-06 AT3G57660 1801 / 0.0 nuclear RNA polymerase A1 (.1) Lus10040493 [exp] 45 / 5e-06 AT3G57660 1802 / 0.0 nuclear RNA polymerase A1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G140850 [exp] 191 / 2e-58 ATCG00180 1181 / 0.0 DNA-directed RNA polymerase family protein (.1) Potri.019G028000 [exp] 166 / 8e-52 ATCG00180 516 / 0.0 DNA-directed RNA polymerase family protein (.1) Potri.001G341900 [exp] 47 / 6e-07 AT5G60040 1858 / 0.0 nuclear RNA polymerase C1 (.1.2) Potri.005G107600 [exp] 45 / 2e-06 AT4G35800 2836 / 0.0 RNA polymerase II large subunit (.1) Potri.006G055300 [exp] 42 / 2e-05 AT3G57660 1890 / 0.0 nuclear RNA polymerase A1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04997 [flax] [poplar] RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1
Representative CDS sequence Show only first row Show all	>Lus10009499 pacid=23147330 polypeptide=Lus10009499 locus=Lus10009499.g ID=Lus10009499.BGIv1.0 annot-version=v1.0 ATGCAAGAAGCCGTTCTTCCTCCTGAGTTGAGACCCCTCGTTCACGTAGCTGAGGATAAGTTAATCAGTTCAGATATTAATGAACTCTATCGAAACGTTA TTTATCGGAACAATATTCTTACTGATCTATTAACAACAAGTAAATCCACGCCAGGGGAATTAGTAATGTCTCAGGAGGGTTTGTTACAAGAAGCTGTGGA TAGACTTCTTGATAATGGAAGCTGCGGACAACCAATGAGGGACGGTCATGATAGGCTTTACAAATCGTTTTCGGATGTAATTGAAGGCAAAGAGGGAAGG TTTCGCGAGACTATGCTCGGCAAACGGGTTGATTATTCGGGGCGTTCCATCAATGTGGATTGCCTCGTGAAATAG
AA sequence Show only first row Show all	>Lus10009499 pacid=23147330 polypeptide=Lus10009499 locus=Lus10009499.g ID=Lus10009499.BGIv1.0 annot-version=v1.0 MQEAVLPPELRPLVHVAEDKLISSDINELYRNVIYRNNILTDLLTTSKSTPGELVMSQEGLLQEAVDRLLDNGSCGQPMRDGHDRLYKSFSDVIEGKEGR FRETMLGKRVDYSGRSINVDCLVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
ATCG00180		ATCG00180.1, RP...	DNA-directed RNA polymerase fa...		Lus10009499 [exp]	0	1
ATCG00830		ATCG00830.1, RP...	ribosomal protein L2 (.1)		Lus10001687 [exp]	1.0	0.9864
ATCG00160		ATCG00160.1, RP...	ribosomal protein S2 (.1)		Lus10013628 [exp]	2.0	0.9656
ATCG00670		PCLPP, ATCG0067...	CASEINOLYTIC PROTEASE P 1, pla...		Lus10006595 [exp]	2.4	0.9466
ATCG00500		ATCG00500.1, AC...	acetyl-CoA carboxylase carboxy...		Lus10002473 [exp]	2.8	0.9449
AT1G06950		ATTIC110, TIC11...	ARABIDOPSIS THALIANA TRANSLOCO...		Lus10026424 [exp]	6.0	0.9318
AT4G31210			DNA topoisomerase, type IA, co...		Lus10026991 [exp]	6.3	0.9368
AT2G39930		ATISA1, ISA1	ARABIDOPSIS THALIANA ISOAMYLAS...		Lus10017150 [exp]	6.9	0.9339
AT5G43270	SBP	SPL2	squamosa promoter binding prot...		Lus10006411 [exp]	6.9	0.8769
AT1G06950		ATTIC110, TIC11...	ARABIDOPSIS THALIANA TRANSLOCO...		Lus10042232 [exp]	7.1	0.9292
AT2G02750			Pentatricopeptide repeat (PPR)...		Lus10030787 [exp]	7.4	0.9269

Compare expression of checked genes

Lus10009499 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.