Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72940 107 / 6e-28 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72920 104 / 2e-27 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G17680 106 / 7e-27 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT1G72930 99 / 1e-26 TIR toll/interleukin-1 receptor-like (.1.2) AT5G36930 105 / 2e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72900 100 / 2e-25 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72910 100 / 4e-25 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G17600 100 / 1e-24 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G17615 98 / 2e-24 Disease resistance protein (TIR-NBS class) (.1) AT5G18360 97 / 1e-23 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030498 [exp] 155 / 8e-48 AT5G36930 115 / 2e-29 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10012852 [exp] 136 / 9e-40 AT5G17680 100 / 1e-23 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10012063 [exp] 126 / 6e-36 AT5G36930 124 / 5e-34 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10026845 [exp] 124 / 7e-35 AT5G36930 145 / 8e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029921 [exp] 125 / 1e-34 AT5G36930 105 / 7e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041606 [exp] 122 / 4e-34 AT5G36930 140 / 5e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10006929 [exp] 107 / 8e-29 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10027920 [exp] 109 / 9e-29 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029919 [exp] 106 / 1e-28 AT5G36930 105 / 5e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G004233 [exp] 112 / 1e-30 AT1G27170 153 / 8e-42 transmembrane receptors;ATP binding (.1.2) Potri.005G003900 [exp] 108 / 2e-29 AT5G36930 146 / 8e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.004G230000 [exp] 108 / 4e-29 AT5G36930 169 / 4e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G004500 [exp] 105 / 2e-28 AT5G36930 152 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G070436 [exp] 104 / 2e-28 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G016425 [exp] 106 / 1e-26 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G007884 [exp] 105 / 2e-26 AT5G36930 654 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.006G269950 [exp] 100 / 3e-26 AT5G36930 147 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G069866 [exp] 99 / 4e-26 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G068300 [exp] 104 / 5e-26 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10009500 pacid=23147307 polypeptide=Lus10009500 locus=Lus10009500.g ID=Lus10009500.BGIv1.0 annot-version=v1.0 ATGAAAATTAAAATCAAACAACATGAATTAACAGTGGGGAACCACCGCCGCCGCCGCCATGACGTATTCGTAAGCTTCCGAGGCATAGACGTCCGCTACA AATTTGTGGATCATCTCTTCTCCGCCTTCCGGAGGAAGAAAGTGAAGGCGTTCAGAGATACTAGCGACTCAAGCAGAGGACAACTCATCGACGAGGAGAT CCCACTGGCAATTGACGAGTCGAGCTTTTACGTTGTGGTTCTATCCGAAAACTACGATTCGTCTCCATGGTGCTTGGATGAGCTCGTCATGATCATGGAC AACTCCCGCGGTGGGAAGATGGTATTCCCCATATTCTACCATGTGTTGCCGGACGATGTCTCCTCCGTGGACGCCGTTCACCGGATCAAAGGTCAGTACA CGTACGAAAGAGTGGAGAGATGGATTGAGGCGCTGGATTGGATCGCGAGGATTGCTGGCTGGGTCGTCACTGTCAGAGGCGTCGGTGGTGGAGAGTATTG CCCGAATCATCCAACGCAGGGTTCGAAGGAAGGGGAAGCGCATCCGGATGAATCGAGGCACTAA
AA sequence Show only first row Show all	>Lus10009500 pacid=23147307 polypeptide=Lus10009500 locus=Lus10009500.g ID=Lus10009500.BGIv1.0 annot-version=v1.0 MKIKIKQHELTVGNHRRRRHDVFVSFRGIDVRYKFVDHLFSAFRRKKVKAFRDTSDSSRGQLIDEEIPLAIDESSFYVVVLSENYDSSPWCLDELVMIMD NSRGGKMVFPIFYHVLPDDVSSVDAVHRIKGQYTYERVERWIEALDWIARIAGWVVTVRGVGGGEYCPNHPTQGSKEGEAHPDESRH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G72940			Toll-Interleukin-Resistance (T...		Lus10009500 [exp]	0	1
AT2G32450			Calcium-binding tetratricopept...		Lus10038571 [exp]	1.4	0.7768
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10021992 [exp]	3.9	0.8265
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10029184 [exp]	13.2	0.7722
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10030510 [exp]	14.9	0.7275
AT5G39200			unknown protein		Lus10030710 [exp]	16.1	0.7275
AT4G17920			RING/U-box superfamily protein...		Lus10030972 [exp]	17.2	0.7275
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10031391 [exp]	18.2	0.7275
AT1G17930			Aminotransferase-like, plant m...		Lus10005495 [exp]	19.2	0.7275
AT1G60420			DC1 domain-containing protein ...		Lus10029148 [exp]	19.6	0.7285
					Lus10025316 [exp]	20.2	0.7275

Compare expression of checked genes

Lus10009500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.