Lus10009505 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52190 207 / 1e-63 Major facilitator superfamily protein (.1)
AT3G16180 197 / 5e-60 Major facilitator superfamily protein (.1)
AT5G11570 147 / 1e-41 Major facilitator superfamily protein (.1)
AT1G69870 146 / 1e-40 NRT1.7 nitrate transporter 1.7 (.1)
AT1G27080 139 / 4e-38 NRT1.6 nitrate transporter 1.6 (.1)
AT1G18880 132 / 1e-35 NRT1.9 nitrate transporter 1.9, Major facilitator superfamily protein (.1)
AT5G01180 127 / 6e-34 ATPTR5 ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 5, peptide transporter 5 (.1)
AT5G46050 127 / 9e-34 ATPTR3, PTR3 ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 3, peptide transporter 3 (.1)
AT3G54140 126 / 1e-33 ATPTR1 ARABIDOPSIS THALIANA PEPTIDE TRANSPORTER 1, peptide transporter 1 (.1)
AT1G33440 125 / 3e-33 Major facilitator superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038615 204 / 2e-65 AT1G27080 146 / 8e-40 nitrate transporter 1.6 (.1)
Lus10035860 186 / 1e-55 AT1G52190 787 / 0.0 Major facilitator superfamily protein (.1)
Lus10025802 171 / 8e-50 AT1G52190 764 / 0.0 Major facilitator superfamily protein (.1)
Lus10023663 163 / 6e-47 AT3G16180 559 / 0.0 Major facilitator superfamily protein (.1)
Lus10037896 141 / 6e-39 AT1G52190 479 / 3e-163 Major facilitator superfamily protein (.1)
Lus10038616 139 / 1e-38 AT1G52190 446 / 2e-151 Major facilitator superfamily protein (.1)
Lus10036705 139 / 4e-38 AT1G69870 709 / 0.0 nitrate transporter 1.7 (.1)
Lus10037221 138 / 1e-37 AT1G69870 709 / 0.0 nitrate transporter 1.7 (.1)
Lus10015351 136 / 4e-37 AT1G18880 682 / 0.0 nitrate transporter 1.9, Major facilitator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G041800 214 / 3e-66 AT1G52190 551 / 0.0 Major facilitator superfamily protein (.1)
Potri.001G185700 213 / 1e-65 AT1G52190 785 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041700 204 / 1e-62 AT1G52190 562 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G040500 204 / 2e-62 AT1G52190 561 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041400 204 / 2e-62 AT1G52190 562 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041500 201 / 2e-61 AT1G52190 561 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G041600 201 / 3e-61 AT1G52190 590 / 0.0 Major facilitator superfamily protein (.1)
Potri.018G040400 182 / 2e-54 AT3G16180 559 / 0.0 Major facilitator superfamily protein (.1)
Potri.012G087500 167 / 2e-48 AT1G52190 542 / 0.0 Major facilitator superfamily protein (.1)
Potri.006G240000 145 / 2e-40 AT1G52190 628 / 0.0 Major facilitator superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00854 PTR2 POT family
Representative CDS sequence
>Lus10009505 pacid=23147327 polypeptide=Lus10009505 locus=Lus10009505.g ID=Lus10009505.BGIv1.0 annot-version=v1.0
ATGGCGATGAACATCAGCCAGGGCTCCTTCCAAACAATCATGGCGGCCAACATGGACCGCCACGTCACCCCACAGCTGCAGATCCCGGCCGGATCCCTTG
GAGTCTTCATGATCGTTACATTAGCTTTATGGGTGGTCGTATACGACCGGGTCATAATCCCCATCGGATACAAGATCAGGGGTGAACCGACCCGCCTCAC
AATCAAACAGCGAATGGGAATTGGAATCCTCTTCTCCTCCCTAGCCATGGTGGCCCTAGCTGTCGTCGAGTCCTACAGCCGCAGAATCGCGATCGGCGGG
GAAAAGATGATGTGGGCGATATGGATGATGCCGCATCTGGTCCTCCTCGGCCTGGCGGAGGGACTGAACGCTACAGCGCAGATCGAGTTCTATTACAACG
AGCTTCCAAGGAGCATGAGCAGCATAGCTACGTCACTCTGGGGAATGGCGTTGTCTGGCGCAGGCTTGGCGTCAAGCTTGATTGTGAGCGCCGTCGATGA
GGTTACGAAGAAGAAGAAGAACGGAAGGGAAGAGTCAGAGAGCTGGACATCGAGCGATATCAATAAAGGGCATTACGATTACTATTACTGGCTGCTGGCG
TCGCTGAGCTTTTGCCAATTTTGTGTATTATTTGGGGTGCTCCAAAGCTTATGGGCCTAG
AA sequence
>Lus10009505 pacid=23147327 polypeptide=Lus10009505 locus=Lus10009505.g ID=Lus10009505.BGIv1.0 annot-version=v1.0
MAMNISQGSFQTIMAANMDRHVTPQLQIPAGSLGVFMIVTLALWVVVYDRVIIPIGYKIRGEPTRLTIKQRMGIGILFSSLAMVALAVVESYSRRIAIGG
EKMMWAIWMMPHLVLLGLAEGLNATAQIEFYYNELPRSMSSIATSLWGMALSGAGLASSLIVSAVDEVTKKKKNGREESESWTSSDINKGHYDYYYWLLA
SLSFCQFCVLFGVLQSLWA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52190 Major facilitator superfamily ... Lus10009505 0 1
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10042436 7.7 0.6729
AT5G59380 MBD6, ATMBD6 methyl-CPG-binding domain 6 (.... Lus10029564 14.6 0.6530
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Lus10032214 16.3 0.6530
AT4G19570 Chaperone DnaJ-domain superfam... Lus10028524 17.5 0.5516
Lus10011314 18.9 0.6465
AT5G22460 alpha/beta-Hydrolases superfam... Lus10004882 21.7 0.6357
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10006277 23.7 0.6357
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10025981 25.7 0.6357
AT4G33920 Protein phosphatase 2C family ... Lus10000700 27.4 0.6357
AT1G01450 Protein kinase superfamily pro... Lus10041113 29.1 0.6357

Lus10009505 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.