Plant FIBer expression Database

Lus10009508 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32780 41 / 0.0001 phosphoinositide binding (.1)
AT3G63300 39 / 0.0005 FKD1 FORKED 1 (.1.2)
AT4G14740 39 / 0.0008 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G042000
[exp]
79 / 6e-18 AT4G32785 159 / 1e-47 unknown protein
Potri.010G082400
[exp]
40 / 0.0002 AT4G14740 468 / 1e-162 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05703 Auxin_canalis Auxin canalisation
Representative CDS sequence
>Lus10009508 pacid=23147312 polypeptide=Lus10009508 locus=Lus10009508.g ID=Lus10009508.BGIv1.0 annot-version=v1.0
ATGAGAAGTTGTACCAGAGCTACTCTGACACTTGAACTGGAAGAAGAGGAAGAAGATGAACAAAAGTATAACGCAACAAGAATGAGCTCTTGCAGTACCA
AGAGCCTGCTGCAGAAGTTGGAGAACATTGATGAGAATGCTCCTGCTTCATGGGGAGGACATTCCACATCTTCCTCTGCTCCACCGCCTGAGACTCCGAC
CGGGTCCATGGAGTTTCTAGCTAGATCATGGAGTCTTTCCGCCATGGAGCTCTCCAGAGCTCTTTCCACACATCCACCTCCTCCTCCTGCTTGTCTCCAC
AACTTGCACACTAATCCTCCTAAACCTGCTGATCAATGCCAGGATGCAAGTTCTGCAGCCGCAAATGCATCTTTGGTAAGTGGCGGAGGTCCTGCTAGCC
CCCCTATCTCTCCGAGAGATAGTGAAGATCTTAAGGTACTACTTTCTCCAGTAAGTGCTGACTCTTAA
AA sequence
>Lus10009508 pacid=23147312 polypeptide=Lus10009508 locus=Lus10009508.g ID=Lus10009508.BGIv1.0 annot-version=v1.0
MRSCTRATLTLELEEEEEDEQKYNATRMSSCSTKSLLQKLENIDENAPASWGGHSTSSSAPPPETPTGSMEFLARSWSLSAMELSRALSTHPPPPPACLH
NLHTNPPKPADQCQDASSAAANASLVSGGGPASPPISPRDSEDLKVLLSPVSADS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32780 phosphoinositide binding (.1) Lus10009508
[exp]
0 1
AT4G00752 UBX domain-containing protein ... Lus10036564
[exp]
3.5 0.8950
AT2G42200 SBP SPL9, AtSPL9 squamosa promoter binding prot... Lus10012020
[exp]
3.6 0.8982
AT1G28390 Protein kinase superfamily pro... Lus10018542
[exp]
5.7 0.8733
AT2G42200 SBP SPL9, AtSPL9 squamosa promoter binding prot... Lus10016275
[exp]
6.5 0.8947
AT1G75240 ZF_HD ATHB33, ZHD5 zinc-finger homeodomain 5, hom... Lus10026010
[exp]
6.7 0.8870
AT3G27390 unknown protein Lus10022317
[exp]
7.5 0.8510
AT3G52490 Double Clp-N motif-containing ... Lus10008970
[exp]
7.7 0.8880
AT2G18360 alpha/beta-Hydrolases superfam... Lus10025873
[exp]
8.5 0.8636
AT2G42200 SBP SPL9, AtSPL9 squamosa promoter binding prot... Lus10021034
[exp]
9.9 0.8753
AT3G22810 Plant protein of unknown funct... Lus10009509
[exp]
10.0 0.8655

Lus10009508 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.