Lus10009514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010883 62 / 7e-12 ND /
Lus10001304 60 / 1e-08 AT5G08020 40 / 0.006 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Lus10000293 53 / 1e-08 ND 48 / 2e-05
Lus10036312 0 / 1 AT5G08020 67 / 3e-11 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10009514 pacid=23147315 polypeptide=Lus10009514 locus=Lus10009514.g ID=Lus10009514.BGIv1.0 annot-version=v1.0
ATGGTGATGCGTTATCAATCTTCTATTTCTTTCTTAGGACAACAACGGCGGCTAAGTAACCTCAATCTCCGCAACCTGTATCTCCTTCATTATCCAAGGA
TGACCAACCCTTCTCCAAAGTTTTCTTACAAAACGGTCGCTTTCTACCTCCCACGCAAGCCAGCTGCCTTTGCCAGATCCTTCTGCTGTCGGATCTCCAG
TTACCCAGCCTTTACTCCACCACCGCAGGAACAAGTTCTCGAGCATGCACGTTCCATCATGCAGGATGGCTCTGACTATATGAAAAAATCAACAGCTATT
TTGAGATTGCATCTTCCTTTGGCAAAAGTTAAACTGGAAAAACTCCAAGCATCTTCTGTTACCGTTCCTATTACTCCCCAACCAGTGCTTGGCGATGGGA
TGCATCCACAACTTGGTCAAGGGATGCGCAGCCAGACCAGAAAACGACTTTTCGACAAGTGA
AA sequence
>Lus10009514 pacid=23147315 polypeptide=Lus10009514 locus=Lus10009514.g ID=Lus10009514.BGIv1.0 annot-version=v1.0
MVMRYQSSISFLGQQRRLSNLNLRNLYLLHYPRMTNPSPKFSYKTVAFYLPRKPAAFARSFCCRISSYPAFTPPPQEQVLEHARSIMQDGSDYMKKSTAI
LRLHLPLAKVKLEKLQASSVTVPITPQPVLGDGMHPQLGQGMRSQTRKRLFDK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10009514 0 1
Lus10009515 1.0 0.9445
AT3G24120 GARP Homeodomain-like superfamily p... Lus10038735 2.4 0.9248
AT4G12790 P-loop containing nucleoside t... Lus10041086 9.0 0.9141
AT2G19480 NFA2, NFA02, NA... NUCLEOSOME/CHROMATIN ASSEMBLY ... Lus10037630 10.5 0.8911
AT2G26590 RPN13 regulatory particle non-ATPase... Lus10021598 12.7 0.8781
AT1G11340 S-locus lectin protein kinase ... Lus10018406 13.7 0.8931
AT5G17290 ATG5, APG5, ATA... AUTOPHAGY 5, autophagy protein... Lus10029817 15.3 0.8626
AT1G59077 unknown protein Lus10022089 16.7 0.8555
AT4G16280 FCA RNA binding;abscisic acid bind... Lus10006305 17.2 0.8777
AT5G04260 WCRKC2 WCRKC thioredoxin 2 (.1) Lus10037975 17.7 0.8606

Lus10009514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.