Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64900 67 / 1e-14 CYP89A2 "cytochrome P450, family 89, subfamily A, polypeptide 2", cytochrome P450, family 89, subfamily A, polypeptide 2 (.1) AT3G03470 67 / 2e-14 CYP89A9 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1) AT1G64930 66 / 4e-14 CYP89A7 "cytochrome P450, family 87, subfamily A, polypeptide 7", cytochrome P450, family 87, subfamily A, polypeptide 7 (.1) AT2G12190 66 / 4e-14 CYP89A4 Cytochrome P450 superfamily protein (.1) AT1G64950 64 / 1e-13 CYP89A5 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) AT1G64940 64 / 2e-13 CYP89A6 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) AT5G61320 57 / 5e-11 CYP89A3 "cytochrome P450, family 89, subfamily A, polypeptide 3", cytochrome P450, family 89, subfamily A, polypeptide 3 (.1) AT1G11600 40 / 7e-05 CYP77B1 "cytochrome P450, family 77, subfamily B, polypeptide 1", cytochrome P450, family 77, subfamily B, polypeptide 1 (.1) AT2G22330 38 / 0.0002 CYP79B3 "cytochrome P450, family 79, subfamily B, polypeptide 3", cytochrome P450, family 79, subfamily B, polypeptide 3 (.1) AT2G14100 37 / 0.0005 CYP705A13 "cytochrome P450, family 705, subfamily A, polypeptide 13", cytochrome P450, family 705, subfamily A, polypeptide 13 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020354 [exp] 180 / 5e-61 AT3G03470 68 / 9e-15 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1) Lus10009536 [exp] 86 / 1e-21 AT1G64940 290 / 1e-95 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020359 [exp] 82 / 7e-20 AT1G64940 550 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020353 [exp] 82 / 8e-20 AT1G64940 572 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10028654 [exp] 82 / 2e-19 AT1G64940 562 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020356 [exp] 80 / 2e-19 AT1G64940 243 / 2e-77 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10020360 [exp] 75 / 3e-17 AT1G64940 613 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10002138 [exp] 70 / 1e-15 AT1G64940 586 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Lus10010229 [exp] 66 / 7e-14 AT1G64940 574 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G088086 [exp] 75 / 3e-17 AT1G64950 636 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G087950 [exp] 74 / 4e-17 AT1G64950 642 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088154 [exp] 74 / 4e-17 AT1G64950 639 / 0.0 "cytochrome P450, family 89, subfamily A, polypeptide 5", cytochrome P450, family 89, subfamily A, polypeptide 5 (.1) Potri.007G088018 [exp] 74 / 6e-17 AT1G64940 605 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076700 [exp] 72 / 3e-16 AT1G64940 592 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.013G076600 [exp] 71 / 6e-16 AT1G64940 578 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.005G079600 [exp] 71 / 7e-16 AT1G64940 575 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.001G330501 [exp] 69 / 3e-15 AT1G64940 569 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.015G006100 [exp] 68 / 7e-15 AT1G64940 484 / 7e-168 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1) Potri.008G099100 [exp] 66 / 6e-14 AT1G64940 540 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 6", cytochrome P450, family 87, subfamily A, polypeptide 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10009534 pacid=23145722 polypeptide=Lus10009534 locus=Lus10009534.g ID=Lus10009534.BGIv1.0 annot-version=v1.0 ATGGAGGATTTCTGGTTCCTTATCCTAGTCTCCCTCTCGATAGCCTTACTCCACAAATTCTTCATTAACCTTTTCTCATCCTCCTACGCGGGAAAACCAA CTCCCCCGAAGGATGGGATTGTGAATTTCATGGTAGCGCAGATAGGACTTAATCTAGAAGGGTGGGGGGATCCGTTGTCATTTAAGCCAGAGAGGTTTTT GGACGATACAAAACCGTTTGATTTAACGTCCAGTAAAGAAATTAACATGATTCAGTTCGGTGCGGGGTAG
AA sequence Show only first row Show all	>Lus10009534 pacid=23145722 polypeptide=Lus10009534 locus=Lus10009534.g ID=Lus10009534.BGIv1.0 annot-version=v1.0 MEDFWFLILVSLSIALLHKFFINLFSSSYAGKPTPPKDGIVNFMVAQIGLNLEGWGDPLSFKPERFLDDTKPFDLTSSKEINMIQFGAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03470		CYP89A9	"cytochrome P450, family 87, s...		Lus10009534 [exp]	0	1
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	18.2	0.6734
AT5G46850			unknown protein		Lus10030954 [exp]	28.5	0.6342
AT1G08230		ATGAT1	L-GAMMA-AMINOBUTYRIC ACID TRAN...		Lus10037913 [exp]	195.5	0.5374

Compare expression of checked genes

Lus10009534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.