Lus10009538 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09815 86 / 5e-23 POLD4 polymerase delta 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020362 181 / 8e-61 AT1G09815 100 / 3e-28 polymerase delta 4 (.1)
Lus10024978 119 / 6e-36 AT1G09815 129 / 8e-40 polymerase delta 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G076400 87 / 3e-23 AT1G09815 154 / 1e-49 polymerase delta 4 (.1)
Potri.019G042900 83 / 1e-21 AT1G09815 152 / 8e-49 polymerase delta 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04081 DNA_pol_delta_4 DNA polymerase delta, subunit 4
Representative CDS sequence
>Lus10009538 pacid=23145717 polypeptide=Lus10009538 locus=Lus10009538.g ID=Lus10009538.BGIv1.0 annot-version=v1.0
ATGATGAAGTCGTACTACAAGCAAAAGAAGACTAACCGTGCTTCCGACGTCGGCAAGCCTTCACAGTCGTCCAAGTCAATCAAGAAGAAATCGCCGGCGG
TATCTCAACCGATCTCTCCTCGCGACGACGACAAAGTGCTGGAGAAGAGCGAGCAGGTGCTGAGGGAGTTCGATATGAACATGGCGTACGGACCTTGCAT
CGGGATGACTAGATCGGCTCGATGGGAGCGCGCTCATCGGCTGGGATTGAATCCTTCTGGGGAGATTAAGAATCTGCTAGATGCTGGAGAGGGGAATGCG
CTGAGCGTCTGGGATGGGCGTGTCTGA
AA sequence
>Lus10009538 pacid=23145717 polypeptide=Lus10009538 locus=Lus10009538.g ID=Lus10009538.BGIv1.0 annot-version=v1.0
MMKSYYKQKKTNRASDVGKPSQSSKSIKKKSPAVSQPISPRDDDKVLEKSEQVLREFDMNMAYGPCIGMTRSARWERAHRLGLNPSGEIKNLLDAGEGNA
LSVWDGRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09815 POLD4 polymerase delta 4 (.1) Lus10009538 0 1
AT3G42860 zinc knuckle (CCHC-type) famil... Lus10012906 3.3 0.8799
AT2G28740 HIS4 histone H4 (.1) Lus10025964 6.0 0.8972
AT5G49010 EMB2812, SLD5 SYNTHETIC LETHALITY WITH DPB11... Lus10017669 10.2 0.8961
AT3G48710 DEK domain-containing chromati... Lus10035905 14.1 0.8666
AT4G28950 ATRAC7, ARAC7, ... Arabidopsis RAC-like 7, RHO-re... Lus10023660 15.0 0.8631
AT1G04150 C2 calcium/lipid-binding plant... Lus10000164 15.4 0.8904
AT3G13960 GRF ATGRF5 growth-regulating factor 5 (.1... Lus10004455 16.1 0.8663
AT3G27360 Histone superfamily protein (.... Lus10031252 17.0 0.8815
AT5G10400 Histone superfamily protein (.... Lus10031822 17.4 0.8910
AT3G53730 Histone superfamily protein (.... Lus10023331 17.6 0.8896

Lus10009538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.