Lus10009560 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61540 517 / 0 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
AT3G16150 77 / 1e-15 ASPGB1 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
AT5G08100 66 / 7e-12 ASPGA1 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT4G00590 59 / 2e-09 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020385 533 / 0 AT5G61540 429 / 1e-147 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10034655 84 / 1e-17 AT5G08100 507 / 0.0 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10034668 82 / 2e-17 AT5G08100 489 / 6e-176 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10024795 74 / 2e-14 AT3G16150 536 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10040935 59 / 4e-09 AT4G00590 484 / 8e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009826 56 / 3e-08 AT4G00590 446 / 2e-156 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G191900 527 / 0 AT5G61540 497 / 2e-177 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.002G122900 80 / 2e-16 AT3G16150 540 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.012G063400 71 / 2e-13 AT5G08100 485 / 2e-174 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G022900 69 / 8e-13 AT3G16150 556 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.014G080600 61 / 8e-10 AT4G00590 486 / 1e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF01112 Asparaginase_2 Asparaginase
Representative CDS sequence
>Lus10009560 pacid=23145731 polypeptide=Lus10009560 locus=Lus10009560.g ID=Lus10009560.BGIv1.0 annot-version=v1.0
ATGCGGAAGGCAAGCTTCTCCATCGGTTTCGTCTCCTCACTCACTTTGTTCCTCGCGGTAATTAACTTCCTCCCCTCCCGCGTCTTTGGTCCTCTCTTTC
TATCTAAATCCACAGTGTGCCTAATCGATCTCGTTTTTCTCCTTGGAGGTTTTCAGTTGGTTGGTGGCTCCTCCGTCGTGGGGGATCCGTTAGTAGTGAG
TACCTGGCCGTTCAAGGAAGCAGTCAGAGCTGCTTGGACGGCCGTTGACTCCGGCCTTTCCGCCGTCGAATCCGTCGTGGAAGGCTGCTCCGCTTGTGAA
GTGCTCAGGTGCGATGGCACCGTAGGACCTGGTGGAAGTCCTGATGAGAATGGAGAAACCACCATTGATGCCATGATTATGAATGGGGTAACAATGGAGG
TCGGGGCAGTCGGAGCCATGAGGTATGTGAAAGATGGCATAAGAGCAGCTAAGCTGGTAATGGATTACTCGAAGCACACTTTCCTAGTTGGCGAGAAGGC
TTCTGTTTTCGCCATTTCGATGGGTCTCCAAGGGCCGACGAACCTTAGTTCGGTAGAGTCGATAGAGAAGTGGAGTGCTTGGAGGGACAATGGGTGCCAA
CCCAATTTCAGACAGAATGTCTTGCCTGCAAACGGCTGTGGCCCTTATCATCATAATAACATGGACAAAGGAGAACAAGTGCTGCAGTGTTCTGCCGAGC
CAAGGTCTTCTCTTGTTGGCCCTCACAACCATGACACCATATCAATGGCCGTCATTGATAGAATGGGGCATATTGCTGCTGGTACATCAACTAATGGAGC
TAGTTTTAAGATCCCTGGCAGGGTTGGCGATGGACCCATAGCAGGATCTGCAGCTTACACAGATAGCGAAGTGGGAGCTTGTGGTGCAACTGGCGATGGT
GACATCATGATGCGCTTCCTCCCATGCTACCAAGTTGTGGAGAGTATGAGACGAGGCATGGAACCTAAGCAAGCTGCAGAAGATGCAATCTCTCGCATTG
CAACGAAGTTCCCTGATTTCGTTGGAGCTTTGTTTGCTGTGAATAAGAATGGAGTTCATGCTGGAGCTTGCCATGGATGGATATTCCAGTATTCTGTCAG
GAACTCCCAGATGAACGACGTCCAGGTTTTCACAGTATTACCAGCCAATCGAAAAATACGTTACTGA
AA sequence
>Lus10009560 pacid=23145731 polypeptide=Lus10009560 locus=Lus10009560.g ID=Lus10009560.BGIv1.0 annot-version=v1.0
MRKASFSIGFVSSLTLFLAVINFLPSRVFGPLFLSKSTVCLIDLVFLLGGFQLVGGSSVVGDPLVVSTWPFKEAVRAAWTAVDSGLSAVESVVEGCSACE
VLRCDGTVGPGGSPDENGETTIDAMIMNGVTMEVGAVGAMRYVKDGIRAAKLVMDYSKHTFLVGEKASVFAISMGLQGPTNLSSVESIEKWSAWRDNGCQ
PNFRQNVLPANGCGPYHHNNMDKGEQVLQCSAEPRSSLVGPHNHDTISMAVIDRMGHIAAGTSTNGASFKIPGRVGDGPIAGSAAYTDSEVGACGATGDG
DIMMRFLPCYQVVESMRRGMEPKQAAEDAISRIATKFPDFVGALFAVNKNGVHAGACHGWIFQYSVRNSQMNDVQVFTVLPANRKIRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61540 N-terminal nucleophile aminohy... Lus10009560 0 1
AT2G37480 unknown protein Lus10025314 1.0 0.9433
AT2G02390 GST18, ATGSTZ1 GLUTATHIONE S-TRANSFERASE 18, ... Lus10030274 1.4 0.9403
AT4G24120 ATYSL1, YSL1 YELLOW STRIPE like 1 (.1) Lus10023241 3.9 0.9112
AT4G21380 ARK3 receptor kinase 3 (.1) Lus10027229 6.3 0.8968
AT5G03430 phosphoadenosine phosphosulfat... Lus10013826 7.4 0.9029
AT3G10572 APEM9 ABERRANT PEROXISOME MORPHOLOGY... Lus10040572 8.0 0.9002
AT1G76710 ASHH1 ,SDG26 ASH1-RELATED PROTEIN 1, ASH1 R... Lus10016600 10.4 0.9142
AT5G46410 SSP4 SCP1-like small phosphatase 4 ... Lus10004596 11.6 0.9050
AT3G10260 Reticulon family protein (.1.2... Lus10020718 13.0 0.8836
AT2G39840 TOPP4 type one serine/threonine prot... Lus10004692 13.1 0.8974

Lus10009560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.