Lus10009564 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07490 232 / 2e-79 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1)
AT1G05990 216 / 3e-73 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1)
AT4G12860 206 / 3e-69 UNE14 unfertilized embryo sac 14, EF hand calcium-binding protein family (.1)
AT2G43290 204 / 1e-67 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
AT4G03290 198 / 4e-66 EF hand calcium-binding protein family (.1)
AT3G59440 182 / 2e-59 Calcium-binding EF-hand family protein (.1)
AT5G37770 113 / 1e-32 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1)
AT1G73630 109 / 4e-31 EF hand calcium-binding protein family (.1)
AT1G18210 109 / 7e-31 Calcium-binding EF-hand family protein (.1.2)
AT1G24620 106 / 1e-29 EF hand calcium-binding protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038088 149 / 1e-45 AT3G07490 150 / 7e-46 calmodulin-like 3, ARF-GAP domain 11 (.1)
Lus10020389 143 / 2e-45 AT3G07490 130 / 1e-40 calmodulin-like 3, ARF-GAP domain 11 (.1)
Lus10006644 148 / 3e-45 AT3G07490 148 / 3e-45 calmodulin-like 3, ARF-GAP domain 11 (.1)
Lus10027701 145 / 4e-44 AT2G43290 153 / 2e-46 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
Lus10039986 127 / 2e-37 AT3G07490 132 / 3e-39 calmodulin-like 3, ARF-GAP domain 11 (.1)
Lus10018012 121 / 2e-35 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2)
Lus10009059 117 / 9e-34 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2)
Lus10031345 112 / 6e-32 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2)
Lus10004330 103 / 1e-28 AT1G24620 207 / 2e-69 EF hand calcium-binding protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G239100 244 / 2e-84 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.017G029700 234 / 2e-79 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.007G128600 231 / 3e-78 AT2G43290 218 / 3e-72 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
Potri.018G127100 137 / 6e-41 AT3G07490 132 / 6e-39 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.006G065900 135 / 2e-40 AT3G07490 131 / 1e-38 calmodulin-like 3, ARF-GAP domain 11 (.1)
Potri.017G126200 117 / 3e-34 AT1G66400 155 / 5e-49 calmodulin like 23 (.1)
Potri.004G089400 113 / 1e-32 AT1G66400 157 / 7e-50 calmodulin like 23 (.1)
Potri.012G048200 113 / 2e-32 AT1G18210 188 / 8e-62 Calcium-binding EF-hand family protein (.1.2)
Potri.015G039500 110 / 4e-31 AT1G18210 189 / 6e-62 Calcium-binding EF-hand family protein (.1.2)
Potri.010G107100 108 / 2e-30 AT1G24620 220 / 2e-73 EF hand calcium-binding protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0220 EF_hand PF00036 EF-hand_1 EF hand
Representative CDS sequence
>Lus10009564 pacid=23145694 polypeptide=Lus10009564 locus=Lus10009564.g ID=Lus10009564.BGIv1.0 annot-version=v1.0
ATGGACGCGAACGAGCTGAGGAGAGTGTTCCAGATGTTCGACAAGAACGGGGACGGGCAGATCACGAAGAAGGAGCTGAGCGACTCGCTCCAGAACCTGG
GGATCTACATCCCGGAGGTCGACCTGACGCAGATGATCGAGAAGATCGACGTCAACGGCGACGGATTCGTCGATATGGACGAGTTCGGCGAGCTCTACCA
GACGATCATGGACGAGAGGGACGAGGAGGAGGACATGCGGGAGGCGTTCAACGTTTTCGACCAGAACGGCGACGGATTCATCACCGTCGACGAGCTCCGG
TCCGTGCTGGCGTCCCTGGGCCTCAAGCAAGGCCGCACTGTCGAGGATTGCCGGAGGATGATCATGAAGGTCGACGTCGACGGCGACGGGATGGTTAATT
TCAAGGAGTTCAAGCAGATGATGAAAGGCGGTGGGTTCGCTGCTCTGAGCTCCAGCTGA
AA sequence
>Lus10009564 pacid=23145694 polypeptide=Lus10009564 locus=Lus10009564.g ID=Lus10009564.BGIv1.0 annot-version=v1.0
MDANELRRVFQMFDKNGDGQITKKELSDSLQNLGIYIPEVDLTQMIEKIDVNGDGFVDMDEFGELYQTIMDERDEEEDMREAFNVFDQNGDGFITVDELR
SVLASLGLKQGRTVEDCRRMIMKVDVDGDGMVNFKEFKQMMKGGGFAALSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07490 AtCML3, AGD11 calmodulin-like 3, ARF-GAP dom... Lus10009564 0 1
AT5G47810 PFK2 phosphofructokinase 2 (.1) Lus10008812 2.0 0.9199
AT1G06475 unknown protein Lus10020752 2.0 0.8930
AT5G23100 Protein of unknown function, D... Lus10009615 3.7 0.9075
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10031640 5.0 0.8919
AT3G09770 LOG2 LOSS OF GDU 2, RING/U-box supe... Lus10015080 8.9 0.8789
AT1G27100 Actin cross-linking protein (.... Lus10037230 9.2 0.8847
AT5G42200 RING/U-box superfamily protein... Lus10034551 9.2 0.8512
AT1G68260 Thioesterase superfamily prote... Lus10035143 9.9 0.8789
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10001419 10.6 0.8826
AT2G47470 ATPDI11, ATPDIL... UNFERTILIZED EMBRYO SAC 5, MAT... Lus10020691 11.4 0.8376

Lus10009564 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.