Lus10009567 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26660 60 / 8e-13 AS2 LBD24 LOB domain-containing protein 24 (.1)
AT3G26620 60 / 8e-13 AS2 LBD23 LOB domain-containing protein 23 (.1)
AT5G66870 45 / 1e-06 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1)
AT2G30130 44 / 2e-06 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
AT2G23660 44 / 3e-06 AS2 LBD10 LOB domain-containing protein 10 (.1.2)
AT3G11090 43 / 5e-06 AS2 LBD21 LOB domain-containing protein 21 (.1)
AT4G00210 43 / 5e-06 AS2 LBD31 LOB domain-containing protein 31 (.1)
AT1G31320 43 / 5e-06 AS2 LBD4 LOB domain-containing protein 4 (.1)
AT3G27650 43 / 5e-06 AS2 LBD25 LOB domain-containing protein 25 (.1)
AT4G22700 42 / 1e-05 AS2 LBD32 LOB domain-containing protein 32 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011906 54 / 4e-10 AT5G63090 59 / 4e-11 Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4)
Lus10023591 50 / 2e-08 AT3G26660 52 / 5e-09 LOB domain-containing protein 24 (.1)
Lus10040313 48 / 7e-08 AT5G66870 133 / 5e-40 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1)
Lus10023434 46 / 3e-07 AT3G26660 131 / 5e-40 LOB domain-containing protein 24 (.1)
Lus10025840 45 / 1e-06 AT5G66870 184 / 4e-57 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1)
Lus10006679 45 / 2e-06 AT5G66870 169 / 1e-50 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1)
Lus10009337 45 / 2e-06 AT2G23660 183 / 7e-56 LOB domain-containing protein 10 (.1.2)
Lus10000707 45 / 2e-06 AT2G42430 222 / 2e-72 ASYMMETRIC LEAVES2-LIKE 18, lateral organ boundaries-domain 16 (.1)
Lus10019633 45 / 2e-06 AT5G66870 181 / 7e-55 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G097800 47 / 2e-07 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1)
Potri.007G066700 45 / 6e-07 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1)
Potri.003G149000 44 / 2e-06 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1)
Potri.001G081400 44 / 3e-06 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1)
Potri.015G135900 44 / 3e-06 AT3G26660 165 / 2e-53 LOB domain-containing protein 24 (.1)
Potri.008G072800 43 / 4e-06 AT2G30130 229 / 8e-78 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
Potri.010G184400 43 / 5e-06 AT2G30130 227 / 7e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
Potri.001G345700 43 / 6e-06 AT3G27650 208 / 5e-70 LOB domain-containing protein 25 (.1)
Potri.007G039500 43 / 1e-05 AT5G66870 256 / 1e-84 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1)
Potri.013G156200 42 / 1e-05 AT2G40470 207 / 2e-67 ASYMMETRIC LEAVES2-LIKE 11, LOB domain-containing protein 15 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03195 LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence
>Lus10009567 pacid=23145695 polypeptide=Lus10009567 locus=Lus10009567.g ID=Lus10009567.BGIv1.0 annot-version=v1.0
ATGGGAGATCGTTGTGCCCGCTGTACCTATAGTCGCCGCGCGTGTCCTGCCGATTGCCGCTTCATGCCCTACTTCCCGCCCAACTCTGAAGACTTCCAGC
TGATTGTCCAAGTCTACAAGAGTCAGACGTCCGGTTTCTTGGATCGCAGCCTGGCCGACTTACCCGGGCCAGGAAGACAATACGATCGCGAGTGCTTTGA
CGGAATAATGCATGTGGTCAGAGCTCACTTGCGCAATCCAGTCGGTGGAGCTAGGGCTGAACTGGCTGCGGCACAGTTTCAGCTAGAGTTTCAGTACGGC
CACCCTCCCCCTCCACAGAACTAA
AA sequence
>Lus10009567 pacid=23145695 polypeptide=Lus10009567 locus=Lus10009567.g ID=Lus10009567.BGIv1.0 annot-version=v1.0
MGDRCARCTYSRRACPADCRFMPYFPPNSEDFQLIVQVYKSQTSGFLDRSLADLPGPGRQYDRECFDGIMHVVRAHLRNPVGGARAELAAAQFQLEFQYG
HPPPPQN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26660 AS2 LBD24 LOB domain-containing protein ... Lus10009567 0 1
AT5G04530 KCS19 3-ketoacyl-CoA synthase 19 (.1... Lus10040333 1.0 0.9697
AT2G42840 PDF1 protodermal factor 1 (.1) Lus10007352 5.5 0.9676
AT3G54200 Late embryogenesis abundant (L... Lus10018361 5.6 0.9283
AT5G65590 DOF AtDof5,7 Dof-type zinc finger DNA-bindi... Lus10025707 6.0 0.9465
AT2G42840 PDF1 protodermal factor 1 (.1) Lus10007351 7.7 0.9615
AT3G63480 ATP binding microtubule motor ... Lus10035343 8.4 0.9522
AT3G52610 unknown protein Lus10014215 8.7 0.9609
AT5G19260 FAF3 FANTASTIC FOUR 3, Protein of u... Lus10042576 9.5 0.9535
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10041924 9.7 0.9592
AT5G65590 DOF AtDof5,7 Dof-type zinc finger DNA-bindi... Lus10035955 10.4 0.9336

Lus10009567 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.