Lus10009568 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07480 213 / 7e-72 2Fe-2S ferredoxin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009565 295 / 6e-104 AT3G07480 236 / 6e-81 2Fe-2S ferredoxin-like superfamily protein (.1)
Lus10020390 278 / 2e-97 AT3G07480 238 / 2e-81 2Fe-2S ferredoxin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G239000 233 / 1e-79 AT3G07480 236 / 5e-81 2Fe-2S ferredoxin-like superfamily protein (.1)
Potri.014G177100 226 / 3e-77 AT3G07480 239 / 2e-82 2Fe-2S ferredoxin-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10009568 pacid=23145707 polypeptide=Lus10009568 locus=Lus10009568.g ID=Lus10009568.BGIv1.0 annot-version=v1.0
ATGGCGACCTCGAGGCTCTATCGACTCTCCTCGCAAATCCACCGTCTCTCTGCTTCATCATCTCCCTTAACCAAATCCATCATCACCCGCTCCTCCGCCA
CCGCCGCGGCTGAAGTAGCTTCCCGAGCAGGCACCGCCAAGGTCTCCGACAGGATCGTGAAGCTCTTTGCGATCGACCCGGAAGGACACAAGCGAGAGAT
CATCGGGCTCACGGGGCAGACTCTACTCAAGGCACTGACCAACCACGGGCTAATCGACCCTGCGTCCCACCGGTTGGAGGACATCGACGCCTGCTCCGCA
GAGTGCGAGGTCAGCATCGCGCAGGAGTGGCTCCAGAGGCTTCCCGCCAGATCCTACGACGAGGAGTACGTGCTGAAGCGGAACTCCAGGGTTAGGGTGC
TGAACCAGCACTCCAGGTTGGGGTGCCAAGTTGTGATCACTTCTCAGCTCCAAGGTATGGTTGTTGCTGTTCCTGAGCCTAGACCGTGGGACACTCCGTA
A
AA sequence
>Lus10009568 pacid=23145707 polypeptide=Lus10009568 locus=Lus10009568.g ID=Lus10009568.BGIv1.0 annot-version=v1.0
MATSRLYRLSSQIHRLSASSSPLTKSIITRSSATAAAEVASRAGTAKVSDRIVKLFAIDPEGHKREIIGLTGQTLLKALTNHGLIDPASHRLEDIDACSA
ECEVSIAQEWLQRLPARSYDEEYVLKRNSRVRVLNQHSRLGCQVVITSQLQGMVVAVPEPRPWDTP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10009568 0 1
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10020390 1.0 0.8668
AT5G59950 RNA-binding (RRM/RBD/RNP motif... Lus10024413 1.4 0.8468
AT4G34700 CIB22, AtCIB22 B22 subunit of eukaryotic mito... Lus10035469 4.9 0.7713
AT5G08060 unknown protein Lus10034681 5.5 0.8260
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10039485 9.6 0.8182
AT5G19910 MED31 SOH1 family protein (.1.2) Lus10021434 10.7 0.7216
AT4G02580 NADH-ubiquinone oxidoreductase... Lus10018762 11.8 0.7634
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10014530 12.2 0.7808
Lus10024103 13.7 0.7772
AT5G01090 Concanavalin A-like lectin fam... Lus10017194 15.9 0.7688

Lus10009568 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.