Lus10009580 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48480 112 / 5e-32 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020400 288 / 5e-101 AT5G48480 111 / 2e-31 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10009579 256 / 8e-89 AT5G48480 111 / 2e-31 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10020399 246 / 8e-85 AT5G48480 110 / 4e-31 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10002100 42 / 6e-05 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G251200 166 / 4e-53 AT5G48480 91 / 2e-23 Lactoylglutathione lyase / glyoxalase I family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0104 Glyoxalase PF06983 3-dmu-9_3-mt 3-demethylubiquinone-9 3-methyltransferase
Representative CDS sequence
>Lus10009580 pacid=23145742 polypeptide=Lus10009580 locus=Lus10009580.g ID=Lus10009580.BGIv1.0 annot-version=v1.0
ATGGCGGAACAAGCTGATGTCCACATTGGAGGTGCCGAGAAGGCCGAGGTGGTGGTCTCCTTCACCGCCGTGAAGCCGCAGCTGCTGGTGGAGGCATCCA
AGGTTAACGACGCTGTCGAGTTCTACAAGGCTGCTCTCGGTGCTGTGGAGACTGGCCGTACCACTCATCCCAAGCGCAAGGCGGACCAGGAGCTCCCTCA
GATCATCTCCGCTCAGCTCCAGCTCGCCGGCACCACCATCCTCGTCTCTGACCATTCTGGCGACTCTGCTCCTGTCGGAACCGGACTGTCACTCTGCTTG
GAGACTAATGACGTCGATGCCGCCGTATCAAAGGCCATCGTAGCAGGAGCTACCTCAGAGGGAGAGATCGCTGAGTCTGACGGCGCGTGCTGTGGAGGTC
GCGTGGGAAAAGTGAAGGATCCATACGGATTTGTGTGGTTCATCTGCTCCTCCTCCTCCCCAGCTCCCAAGTGTGGTGAAACTGAAGTGGAAGCTTGA
AA sequence
>Lus10009580 pacid=23145742 polypeptide=Lus10009580 locus=Lus10009580.g ID=Lus10009580.BGIv1.0 annot-version=v1.0
MAEQADVHIGGAEKAEVVVSFTAVKPQLLVEASKVNDAVEFYKAALGAVETGRTTHPKRKADQELPQIISAQLQLAGTTILVSDHSGDSAPVGTGLSLCL
ETNDVDAAVSKAIVAGATSEGEIAESDGACCGGRVGKVKDPYGFVWFICSSSSPAPKCGETEVEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48480 Lactoylglutathione lyase / gly... Lus10009580 0 1
AT1G67120 ATPases;nucleotide binding;ATP... Lus10035904 1.4 0.9232
AT2G30620 winged-helix DNA-binding trans... Lus10006561 2.0 0.9068
AT1G15190 Fasciclin-like arabinogalactan... Lus10023183 2.4 0.9255
AT5G23570 SGS3, ATSGS3 SUPPRESSOR OF GENE SILENCING 3... Lus10004302 3.7 0.9005
AT2G30620 winged-helix DNA-binding trans... Lus10006562 8.3 0.9219
AT5G49665 Zinc finger (C3HC4-type RING f... Lus10028225 8.9 0.8970
AT3G20390 endoribonuclease L-PSP family ... Lus10040074 11.4 0.8713
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10005893 12.5 0.9006
AT3G22142 Bifunctional inhibitor/lipid-t... Lus10003801 13.4 0.8500
AT2G33845 Nucleic acid-binding, OB-fold-... Lus10002172 13.7 0.8798

Lus10009580 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.