Lus10009581 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020401 97 / 2e-27 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10009581 pacid=23145724 polypeptide=Lus10009581 locus=Lus10009581.g ID=Lus10009581.BGIv1.0 annot-version=v1.0
ATGGCAACTTCCCAGGGTGAAGCAGAGAAGTCTATACAAGAGCTTTCAGGATCTAATCCAGTTACAACTCATGAAGAACTAATCCATACTGAAGGGGAAG
GACAAGATGATCAAGTAAATGAGAAGAGTCCAGTTGATGAGCCGGGAGAGGAGGAGGATGAAGATGAGGAGTTGTGGCCGGCGGCAGAACACCATCAGTC
CCCTGATGCCGAGGAAGACACCAAGGAGGCCGCGGCAGTGACTGCTTTCGATGATGATGACGATGAGAAAGATGATGAAGAGGACATTGTTTGA
AA sequence
>Lus10009581 pacid=23145724 polypeptide=Lus10009581 locus=Lus10009581.g ID=Lus10009581.BGIv1.0 annot-version=v1.0
MATSQGEAEKSIQELSGSNPVTTHEELIHTEGEGQDDQVNEKSPVDEPGEEEDEDEELWPAAEHHQSPDAEEDTKEAAAVTAFDDDDDEKDDEEDIV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10009581 0 1
Lus10020401 1.0 0.9452
AT1G77920 bZIP bZIP transcription factor fami... Lus10042005 3.9 0.9070
AT3G60720 PDLP8 plasmodesmata-located protein ... Lus10036497 6.5 0.9128
AT1G29380 Carbohydrate-binding X8 domain... Lus10004546 6.6 0.9197
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10026009 13.0 0.8991
AT5G46530 AWPM-19-like family protein (.... Lus10004587 13.3 0.9082
Lus10042826 14.3 0.8847
Lus10041944 14.4 0.8947
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Lus10022141 18.3 0.8894
AT4G18340 Glycosyl hydrolase superfamily... Lus10042825 18.8 0.8981

Lus10009581 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.