Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23310 164 / 2e-47 CRK23 cysteine-rich RLK (RECEPTOR-like protein kinase) 23 (.1) AT4G23270 161 / 4e-47 CRK19 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) AT4G23130 161 / 6e-47 RLK6, CRK5 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) AT4G05200 160 / 1e-46 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT4G23280 160 / 2e-46 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) AT4G23150 159 / 5e-46 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1) AT4G21380 159 / 8e-46 ARK3 receptor kinase 3 (.1) AT1G11350 159 / 1e-45 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1) AT1G61610 159 / 1e-45 S-locus lectin protein kinase family protein (.1) AT4G23180 157 / 1e-45 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003156 [exp] 229 / 5e-71 AT3G16030 556 / 0.0 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10009582 [exp] 191 / 2e-57 AT3G16030 498 / 3e-165 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Lus10023391 [exp] 174 / 5e-51 AT1G11300 520 / 5e-168 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) Lus10018405 [exp] 172 / 2e-50 AT4G21380 952 / 0.0 receptor kinase 3 (.1) Lus10007602 [exp] 171 / 7e-50 AT1G65800 788 / 0.0 receptor kinase 2 (.1) Lus10018381 [exp] 160 / 2e-49 AT4G23180 283 / 3e-91 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007603 [exp] 167 / 1e-48 AT4G21380 942 / 0.0 receptor kinase 3 (.1) Lus10018382 [exp] 166 / 1e-48 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Lus10007632 [exp] 166 / 1e-48 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G035850 [exp] 172 / 6e-53 AT4G23270 397 / 6e-134 cysteine-rich RLK (RECEPTOR-like protein kinase) 19 (.1) Potri.019G119851 [exp] 165 / 1e-51 AT4G03230 325 / 1e-104 S-locus lectin protein kinase family protein (.1) Potri.004G028600 [exp] 172 / 1e-50 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.004G026350 [exp] 171 / 1e-50 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1) Potri.004G028701 [exp] 172 / 2e-50 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G125201 [exp] 160 / 6e-50 AT4G27300 328 / 1e-107 S-locus lectin protein kinase family protein (.1) Potri.001G441801 [exp] 160 / 9e-50 AT4G21390 301 / 1e-96 S-locus lectin protein kinase family protein (.1) Potri.011G036100 [exp] 169 / 2e-49 AT1G11340 719 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G036466 [exp] 163 / 2e-49 AT1G11340 411 / 1e-136 S-locus lectin protein kinase family protein (.1) Potri.011G036400 [exp] 169 / 3e-49 AT1G11340 726 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Lus10009583 pacid=23145685 polypeptide=Lus10009583 locus=Lus10009583.g ID=Lus10009583.BGIv1.0 annot-version=v1.0 ATGGCTCTGATATTCGACGTTAAAAAATTGGAAACAAACACTAAACATGTCGTCGGAACATATGGCTATATGGCTCCAGAGTATGCATCATATGGCGTTG TTTCCGTTAAAACCGATGTATTCAGCTTTGGCGTCTTGTTATTGGAACTTGTGAGTGGGAGAAAGAATAATTCCTTCTATAAGCCCGATGAACAACCCGT CATGCTCATTGGATATGCATGGAAATTGTGGAATGAAGGTCTTGGACTACAACTTGTGGACGAAACATTGGGAGACTTCAACAATACAAATGTAATGAGA TGTATTCATATAGGTTTGTTGTGTGTTCAAGATCAAGCTACAGATAGGCCAACTATGTGTGAAGTTGTGATCATGTTGTCCAATGAGACATTAGAGCTTC CTAAGCCAAAGCAGCCTGCATTCTTCAATATTTGTGGCGTTGCAGATGATTTTTGGGAAAATAAAAATCGATGA
AA sequence Show only first row Show all	>Lus10009583 pacid=23145685 polypeptide=Lus10009583 locus=Lus10009583.g ID=Lus10009583.BGIv1.0 annot-version=v1.0 MALIFDVKKLETNTKHVVGTYGYMAPEYASYGVVSVKTDVFSFGVLLLELVSGRKNNSFYKPDEQPVMLIGYAWKLWNEGLGLQLVDETLGDFNNTNVMR CIHIGLLCVQDQATDRPTMCEVVIMLSNETLELPKPKQPAFFNICGVADDFWENKNR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	0	1
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10008441 [exp]	1.4	0.9961
AT4G31920	GARP	ARR10	response regulator 10 (.1)		Lus10025044 [exp]	1.4	0.9966
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031007 [exp]	3.0	0.9911
					Lus10033900 [exp]	3.9	0.9474
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10002774 [exp]	4.5	0.9861
AT1G71530			Protein kinase superfamily pro...		Lus10001470 [exp]	4.9	0.9726
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10042155 [exp]	4.9	0.9512
					Lus10033901 [exp]	5.7	0.9676
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	5.9	0.9679
					Lus10014195 [exp]	5.9	0.9743

Compare expression of checked genes

Lus10009583 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.