Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020406 [exp] 133 / 1e-41 AT3G07425 42 / 4e-06 unknown protein Lus10038229 [exp] 47 / 7e-08 AT3G07425 52 / 3e-10 unknown protein Lus10025871 [exp] 45 / 3e-07 AT3G07425 50 / 4e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G250100 [exp] 58 / 5e-12 AT3G07425 49 / 6e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009587 pacid=23145729 polypeptide=Lus10009587 locus=Lus10009587.g ID=Lus10009587.BGIv1.0 annot-version=v1.0 ATGGCAGAGTATGGAGAAACAGAGACATCCATAACCAATATGCTCAAGAGATCCTTCACAGTCACCATGTCCATGGCGTCAAGCTCCAACAACGTCCTGG CCGCACTATGCCGGCCGCCGCGGCCGCGGCGCCTTAGGAGGCGTAGAGGCAGCACGATAAGGCTCGGGAGCCGCCGGCGAGGACTAGTCTGGCTAGGGAC ACGGCCGGCGGTCGTCCAGTGGGGTGCAATGGCCAGAATGCTGAAGAGGATTTTGATTGACTTAGCTCCTAATTGTTCTCTTAGTTTCGATGCTTATTAC CGGCTTTTGCCGTTTTTACGCCCTCAGAGTTTTCCTCTTTGTTGA
AA sequence Show only first row Show all	>Lus10009587 pacid=23145729 polypeptide=Lus10009587 locus=Lus10009587.g ID=Lus10009587.BGIv1.0 annot-version=v1.0 MAEYGETETSITNMLKRSFTVTMSMASSSNNVLAALCRPPRPRRLRRRRGSTIRLGSRRRGLVWLGTRPAVVQWGAMARMLKRILIDLAPNCSLSFDAYY RLLPFLRPQSFPLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07425			unknown protein		Lus10009587 [exp]	0	1
AT5G14340	MYB	AtMYB40	myb domain protein 40 (.1)		Lus10014569 [exp]	3.3	0.9331
AT2G16750			Protein kinase protein with ad...		Lus10019787 [exp]	3.5	0.9485
AT4G25320	AT-hook		AT hook motif DNA-binding fami...		Lus10031118 [exp]	4.0	0.9576
AT5G57150	bHLH	bHLH035	basic helix-loop-helix (bHLH) ...		Lus10006951 [exp]	5.4	0.9184
AT4G13620	AP2_ERF		Integrase-type DNA-binding sup...		Lus10007124 [exp]	7.7	0.9378
					Lus10035753 [exp]	8.6	0.9141
AT4G34800			SAUR-like auxin-responsive pro...		Lus10007563 [exp]	8.7	0.9381
AT2G19070		SHT	spermidine hydroxycinnamoyl tr...		Lus10001282 [exp]	9.8	0.9353
					Lus10024615 [exp]	9.8	0.9503
AT5G20950			Glycosyl hydrolase family prot...		Lus10001151 [exp]	11.0	0.9301

Compare expression of checked genes

Lus10009587 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.