Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12970 87 / 3e-24 EPFL9, STOMAGEN stomagen (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020408 [exp] 156 / 3e-51 AT4G12970 91 / 9e-25 stomagen (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G249901 [exp] 92 / 9e-26 AT4G12970 103 / 6e-30 stomagen (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009589 pacid=23145716 polypeptide=Lus10009589 locus=Lus10009589.g ID=Lus10009589.BGIv1.0 annot-version=v1.0 ATGCCACAACACAAGCTTCACTCATCCCAGGATGGGGATGAGAAGAGTGAAGATGGGAACATAATCAAAGGAAGAAGCTATGGGAGGAGGCTTCTGATAG GGTCAATGGCACCAATATGTACATACAATGAATGCAGAGGATGTAAGTTGTACACCAAAAAGTGTTGGGCAGAGCAAGTCCCTGTTGAAGGCAATGACCC CATCAACAGTGCTTATCACTACAAATGTGTTTGCCATAGGTAA
AA sequence Show only first row Show all	>Lus10009589 pacid=23145716 polypeptide=Lus10009589 locus=Lus10009589.g ID=Lus10009589.BGIv1.0 annot-version=v1.0 MPQHKLHSSQDGDEKSEDGNIIKGRSYGRRLLIGSMAPICTYNECRGCKLYTKKCWAEQVPVEGNDPINSAYHYKCVCHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G12970		EPFL9, STOMAGEN	stomagen (.1)		Lus10009589 [exp]	0	1
AT3G62030		CYP20-3, ROC4	cyclophilin 20-3, rotamase CYP...		Lus10038015 [exp]	3.5	0.9176
AT1G57750		MAH1, CYP96A15	MID-CHAIN ALKANE HYDROXYLASE 1...		Lus10002523 [exp]	4.6	0.8954
AT3G12080		EMB2738	embryo defective 2738, GTP-bin...		Lus10027371 [exp]	5.1	0.9238
AT5G23690			Polynucleotide adenylyltransfe...		Lus10016719 [exp]	8.1	0.8891
					Lus10021792 [exp]	9.5	0.8881
AT3G21300			RNA methyltransferase family p...		Lus10009743 [exp]	11.6	0.8829
AT3G06120	bHLH	MUTE, bHLH045	MUTE, basic helix-loop-helix (...		Lus10010503 [exp]	14.1	0.8464
AT5G23690			Polynucleotide adenylyltransfe...		Lus10036013 [exp]	17.5	0.8736
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10033717 [exp]	18.0	0.8763
AT5G18570		EMB3138, ATOBGL...	EMBRYO DEFECTIVE 3138, EMBRYO ...		Lus10024297 [exp]	20.3	0.8948

Compare expression of checked genes

Lus10009589 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.