Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009611 pacid=23140106 polypeptide=Lus10009611 locus=Lus10009611.g ID=Lus10009611.BGIv1.0 annot-version=v1.0 ATGGCATCGGCAATTCCATCAGTAATCCCTTCATCAGTCGCCGCCGCCGGCGGAGGCGGGGGAGTAGGAGGTCAGACCGCGCATCCGGCAGCGACGGCTG CTCAAGCCTTATGGATCAGGATCAATCAGACCGTTCTTCGCGGTGGTGTAGGTTCTGGCGGTTATTTCCATCCTGAGTTGCGTCGTGGCTCGCGTGTGCC GCAATCGTGCAGCCGGGAAAGCGACGGCGCCGCCGCGGTTGATGGGGGGAGGATGTTGCTGCTTGTTTGGGTGGCTTAG
AA sequence Show only first row Show all	>Lus10009611 pacid=23140106 polypeptide=Lus10009611 locus=Lus10009611.g ID=Lus10009611.BGIv1.0 annot-version=v1.0 MASAIPSVIPSSVAAAGGGGGVGGQTAHPAATAAQALWIRINQTVLRGGVGSGGYFHPELRRGSRVPQSCSRESDGAAAVDGGRMLLLVWVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009611 [exp]	0	1
AT3G53970			proteasome inhibitor-related (...		Lus10035223 [exp]	3.5	0.7202
AT2G02230		ATPP2-B1	phloem protein 2-B1 (.1)		Lus10029674 [exp]	4.0	0.7783
AT5G24560		ATPP2-B12	phloem protein 2-B12 (.1)		Lus10025666 [exp]	6.0	0.7264
AT5G19260		FAF3	FANTASTIC FOUR 3, Protein of u...		Lus10021930 [exp]	7.3	0.6831
AT5G16530		PIN5	PIN-FORMED 5, Auxin efflux car...		Lus10020193 [exp]	12.4	0.6713
AT1G44750		ATPUP11	purine permease 11 (.1.2.3)		Lus10043350 [exp]	17.6	0.6719
AT5G12890			UDP-Glycosyltransferase superf...		Lus10025513 [exp]	21.9	0.6705
AT4G24050			NAD(P)-binding Rossmann-fold s...		Lus10017308 [exp]	22.0	0.6348
AT1G29220			transcriptional regulator fami...		Lus10007288 [exp]	22.0	0.6023
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Lus10013952 [exp]	23.1	0.7055

Compare expression of checked genes

Lus10009611 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.