Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) AT5G18080 112 / 7e-34 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT3G03850 111 / 2e-33 SAUR-like auxin-responsive protein family (.1) AT5G18020 110 / 4e-33 SAUR-like auxin-responsive protein family (.1) AT2G21200 109 / 5e-33 SAUR-like auxin-responsive protein family (.1) AT4G38850 109 / 6e-33 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT5G18060 109 / 8e-33 SAUR-like auxin-responsive protein family (.1) AT4G34770 109 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT3G03840 109 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT5G18050 108 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008991 [exp] 173 / 9e-58 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 155 / 6e-51 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 151 / 3e-49 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 150 / 5e-49 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 147 / 1e-47 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 140 / 5e-45 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 140 / 6e-45 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 140 / 8e-45 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 140 / 8e-45 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 134 / 1e-42 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 129 / 1e-40 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 128 / 3e-40 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 124 / 1e-38 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 123 / 2e-38 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 116 / 2e-35 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 113 / 2e-34 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 113 / 3e-34 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165400 [exp] 107 / 4e-32 AT5G18080 110 / 3e-33 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 107 / 6e-32 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10009620 pacid=23140104 polypeptide=Lus10009620 locus=Lus10009620.g ID=Lus10009620.BGIv1.0 annot-version=v1.0 ATGGCTAACCTTGTCAAGCAAATTCTACGACGAACTGGCTCTGGATCTAGTAAAGGGCCATCGCGGTTTAAAGATATGCCAAAGGGGTTCTTGGCAGTGT ATGTTGGAGAAGAGACACAAAGGAAGAGATTTGTGGTGCCGGTATCCTATTTGAACCAACCTTTGTTTCAGGATCTGTTGAGCATTGCTGAAGAGGAATT CGGGTTCGATCATCCGATGGGCGGATTGACCATTCCTTGTAGTGAACAAGCTTTCATTTCTGCTACTTCAAACTTGATCAGAACATGA
AA sequence Show only first row Show all	>Lus10009620 pacid=23140104 polypeptide=Lus10009620 locus=Lus10009620.g ID=Lus10009620.BGIv1.0 annot-version=v1.0 MANLVKQILRRTGSGSSKGPSRFKDMPKGFLAVYVGEETQRKRFVVPVSYLNQPLFQDLLSIAEEEFGFDHPMGGLTIPCSEQAFISATSNLIRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009620 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009621 [exp]	1.0	0.9570
AT2G21200			SAUR-like auxin-responsive pro...		Lus10008992 [exp]	2.8	0.8836
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Lus10015712 [exp]	3.9	0.8684
AT4G38840			SAUR-like auxin-responsive pro...		Lus10029198 [exp]	4.6	0.8824
AT1G27940		ABCB13, PGP13	ATP-binding cassette B13, P-gl...		Lus10017271 [exp]	6.3	0.7938
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008999 [exp]	6.5	0.8673
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008995 [exp]	7.5	0.8511
AT1G21460		SWEET1, AtSWEET...	Nodulin MtN3 family protein (....		Lus10028634 [exp]	7.5	0.8820
AT4G10320			tRNA synthetase class I (I, L,...		Lus10025306 [exp]	7.5	0.8107
AT5G62850		ATVEX1, SWEET5,...	VEGETATIVE CELL EXPRESSED1, No...		Lus10022226 [exp]	7.7	0.8212

Compare expression of checked genes

Lus10009620 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.