Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18030 115 / 6e-35 SAUR-like auxin-responsive protein family (.1) AT5G18060 113 / 2e-34 SAUR-like auxin-responsive protein family (.1) AT5G18050 113 / 3e-34 SAUR-like auxin-responsive protein family (.1) AT2G21200 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) AT5G18080 112 / 8e-34 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18010 112 / 9e-34 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT4G38840 112 / 1e-33 SAUR-like auxin-responsive protein family (.1) AT5G18020 111 / 2e-33 SAUR-like auxin-responsive protein family (.1) AT3G03840 109 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT3G03850 107 / 5e-32 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008992 [exp] 167 / 1e-55 AT2G21200 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 144 / 2e-46 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 144 / 4e-46 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 143 / 6e-46 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 143 / 6e-46 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 143 / 6e-46 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10009000 [exp] 142 / 2e-45 AT4G38840 118 / 5e-36 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 142 / 2e-45 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10009624 [exp] 141 / 3e-45 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126300 [exp] 127 / 5e-40 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 125 / 6e-39 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 121 / 2e-37 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 120 / 4e-37 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 117 / 8e-36 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 115 / 3e-35 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 113 / 4e-34 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 111 / 2e-33 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 110 / 4e-33 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G165400 [exp] 109 / 7e-33 AT5G18080 110 / 3e-33 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10009621 pacid=23140020 polypeptide=Lus10009621 locus=Lus10009621.g ID=Lus10009621.BGIv1.0 annot-version=v1.0 ATGGCAATCGGATTGCCTGGTAACCTTGTTAAGAACATTCTTCGACGAACTGGGTCTGGATCCAGCAGAACTTCCTCCTCGAGGTTTCCGGATGTGCCAA AGGGATTCTTGGCGGTATATGTCGGAGAGGCACAGAAGAAGAGGTTTGTAGTGCCATTGTCTTATTTGAGCCAGCCGTTGTTTCAAGATCTGCTGAGCAT TGCTGAAGAGGAGTTCGGGTTCGATCATCCAATGGGCGGATTGACCATTCCTTGCAGTGAAGAGACATTCATCTCTGCCACTTCAAACTTGAGCAGTTCA TAA
AA sequence Show only first row Show all	>Lus10009621 pacid=23140020 polypeptide=Lus10009621 locus=Lus10009621.g ID=Lus10009621.BGIv1.0 annot-version=v1.0 MAIGLPGNLVKNILRRTGSGSSRTSSSRFPDVPKGFLAVYVGEAQKKRFVVPLSYLSQPLFQDLLSIAEEEFGFDHPMGGLTIPCSEETFISATSNLSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009621 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10009620 [exp]	1.0	0.9570
AT1G27940		ABCB13, PGP13	ATP-binding cassette B13, P-gl...		Lus10017270 [exp]	1.4	0.9304
AT2G21200			SAUR-like auxin-responsive pro...		Lus10008992 [exp]	3.0	0.9006
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10007139 [exp]	4.0	0.8992
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008995 [exp]	5.2	0.8671
AT4G10320			tRNA synthetase class I (I, L,...		Lus10025306 [exp]	6.3	0.8412
AT3G01140	MYB	NOK, ATMYB106	NOECK, myb domain protein 106 ...		Lus10015712 [exp]	8.2	0.8531
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10018047 [exp]	8.7	0.8914
AT5G57800		CER3, FLP1, YRE...	FACELESS POLLEN 1, ECERIFERUM ...		Lus10019971 [exp]	8.7	0.8450
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008999 [exp]	9.9	0.8607

Compare expression of checked genes

Lus10009621 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.