Lus10009628 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38840 117 / 1e-35 SAUR-like auxin-responsive protein family (.1)
AT2G21200 114 / 1e-34 SAUR-like auxin-responsive protein family (.1)
AT5G18050 113 / 2e-34 SAUR-like auxin-responsive protein family (.1)
AT5G18020 112 / 6e-34 SAUR-like auxin-responsive protein family (.1)
AT5G18030 112 / 8e-34 SAUR-like auxin-responsive protein family (.1)
AT5G18080 112 / 1e-33 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
AT5G18060 111 / 2e-33 SAUR-like auxin-responsive protein family (.1)
AT5G18010 109 / 1e-32 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1)
AT4G38825 106 / 1e-31 SAUR-like auxin-responsive protein family (.1)
AT3G03840 103 / 2e-30 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009623 174 / 3e-58 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1)
Lus10009001 163 / 8e-54 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1)
Lus10038193 152 / 9e-50 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1)
Lus10027317 146 / 4e-47 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1)
Lus10009624 145 / 7e-47 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1)
Lus10038191 145 / 1e-46 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1)
Lus10039020 144 / 1e-46 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Lus10008994 146 / 2e-46 AT5G18050 113 / 2e-33 SAUR-like auxin-responsive protein family (.1)
Lus10008991 144 / 2e-46 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G126700 139 / 3e-44 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1)
Potri.009G126500 130 / 7e-41 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1)
Potri.009G126300 127 / 1e-39 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1)
Potri.004G165200 122 / 1e-37 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1)
Potri.004G164800 120 / 5e-37 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1)
Potri.004G164600 118 / 5e-36 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1)
Potri.009G126400 115 / 3e-35 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1)
Potri.009G126900 111 / 1e-33 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1)
Potri.004G164700 109 / 8e-33 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Potri.004G165450 109 / 1e-32 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10009628 pacid=23140064 polypeptide=Lus10009628 locus=Lus10009628.g ID=Lus10009628.BGIv1.0 annot-version=v1.0
ATGGCTATTGGATTGCCTGGTAATCTTGCTAAGCAGATTCTCAGAAGATCAGGTTCCGGTTCGAAGAAAGCATCTTCGAGGTTTGCAGATGTGCCAAAGG
GTTACTTAGCAGTTTATGTTGGAGAGACACAGAAGAAGAGATTTCTAGTGCCAGTTTCGTGTCTGAGCCAGCCCTCGTTTCAAGACTTGCTGAGCATGGC
TGAAGACGAGTTCGGGTTTGATCATCCGATGGGTGGATTGACCATTCCTTGCAGTGAAGAAACCTTTATTTCTGCCACTTCAAACTTGAGCAGGCCATGA
AA sequence
>Lus10009628 pacid=23140064 polypeptide=Lus10009628 locus=Lus10009628.g ID=Lus10009628.BGIv1.0 annot-version=v1.0
MAIGLPGNLAKQILRRSGSGSKKASSRFADVPKGYLAVYVGETQKKRFLVPVSCLSQPSFQDLLSMAEDEFGFDHPMGGLTIPCSEETFISATSNLSRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G38840 SAUR-like auxin-responsive pro... Lus10009628 0 1
AT4G38840 SAUR-like auxin-responsive pro... Lus10009001 1.0 0.9917
AT4G38840 SAUR-like auxin-responsive pro... Lus10009623 1.4 0.9872
AT4G38840 SAUR-like auxin-responsive pro... Lus10009486 1.7 0.9824
AT4G38840 SAUR-like auxin-responsive pro... Lus10008991 2.0 0.9700
AT5G64330 JK218, RPT3, NP... ROOT PHOTOTROPISM 3, NON-PHOTO... Lus10040484 3.2 0.9665
AT1G75900 EXL3 GDSL-like Lipase/Acylhydrolase... Lus10003717 6.9 0.9594
AT3G59090 unknown protein Lus10040880 7.9 0.9582
AT1G27950 LTPG1 glycosylphosphatidylinositol-a... Lus10006413 8.1 0.9525
AT1G32780 GroES-like zinc-binding dehydr... Lus10033241 8.9 0.9424
AT4G12690 Plant protein of unknown funct... Lus10006223 9.4 0.9565

Lus10009628 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.