Lus10009629 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02475 235 / 4e-78 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT4G01883 197 / 3e-63 Polyketide cyclase / dehydrase and lipid transport protein (.1)
AT1G02470 183 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009002 326 / 5e-114 AT1G02475 253 / 5e-86 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G190300 237 / 9e-79 AT1G02475 241 / 6e-81 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.014G115400 236 / 2e-78 AT1G02475 217 / 1e-71 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Lus10009629 pacid=23140065 polypeptide=Lus10009629 locus=Lus10009629.g ID=Lus10009629.BGIv1.0 annot-version=v1.0
ATGTCGGCAGCCTTAATCTCAAGCTACTCAACCCCATATCCTACCCTCCATCTAATCAACCCTTCTCTCAAATCGATCGCCGCTTGCAGCACCTCAACGA
CGACGACGCTAAAGCCTCCTCCGACCTTCAGCTGGGTTCATCACCAAAGAAAATGCTCGTCGTCGTCTCGGCCTTCTAAGTTGCTATCCAAATCGTATTC
TCCTCCAGTCATGCAGTGGCAGGATTGCACAGTGAAGAAGGAGATTGATGTGCCGGTTTCCGTTGCTTACAACTGCTATCTGGATCGTGAATCGATTCCG
AAATGGATGCCCTTCATCTCCTCTGTTCAGATACTTGAAGACAAGCCAGACTTATCACGGTGGTCGTTAAAATACGAAGCGTTCGGTCAAGATATCGAAT
TCTCATGGCTTGCTCGAAATATGCAGCCTACTCCAAATCAGAAGATTCATTGGAGATCCCTAGATGGCCTTCCCAACAGGGGTGCTGTTCGATTCTTCCC
GAAAGGGGCCACCTCCTGTACAGTAGAACTGACAGTATCATACGAAGTTCCTCCCATTTTGAGTCCAGTTGCATCAGTAAGCAAGCAGCCCTTTTCCAAA
CCGTATTCGAATCAGATAGGAAACCAAAACGAACCCACCCTTCCGTTCGATTCTGATGATTGGTTTCTGTGTTTCCAGGCACTGCAACCATTCCTTGAGA
ACCTTCTCAGCCGTGGACTGGACAGATTTGCAACGTTCGCCAAAAGCTACTGA
AA sequence
>Lus10009629 pacid=23140065 polypeptide=Lus10009629 locus=Lus10009629.g ID=Lus10009629.BGIv1.0 annot-version=v1.0
MSAALISSYSTPYPTLHLINPSLKSIAACSTSTTTTLKPPPTFSWVHHQRKCSSSSRPSKLLSKSYSPPVMQWQDCTVKKEIDVPVSVAYNCYLDRESIP
KWMPFISSVQILEDKPDLSRWSLKYEAFGQDIEFSWLARNMQPTPNQKIHWRSLDGLPNRGAVRFFPKGATSCTVELTVSYEVPPILSPVASVSKQPFSK
PYSNQIGNQNEPTLPFDSDDWFLCFQALQPFLENLLSRGLDRFATFAKSY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02475 Polyketide cyclase/dehydrase a... Lus10009629 0 1
AT1G75690 LQY1 LOW QUANTUM YIELD OF PHOTOSYST... Lus10024330 15.1 0.8211
AT2G32040 Major facilitator superfamily ... Lus10006106 26.5 0.8013
AT2G32640 Lycopene beta/epsilon cyclase ... Lus10015143 56.0 0.7787
AT1G68830 STN7 STT7 homolog STN7 (.1) Lus10041490 63.5 0.7720
AT5G35630 ATGSL1, GLN2, G... GLUTAMINE SYNTHETASE LIKE 1, g... Lus10001115 86.3 0.7656
AT5G57960 GTP-binding protein, HflX (.1) Lus10024287 86.7 0.7665
AT3G05880 RCI2A RARE-COLD-INDUCIBLE 2A, Low te... Lus10014028 101.8 0.7258
AT3G13050 AtNiaP nicotinate transporter, Major ... Lus10008555 140.1 0.7374
AT1G29530 unknown protein Lus10011974 140.4 0.6979
AT4G20760 NAD(P)-binding Rossmann-fold s... Lus10036204 142.5 0.7296

Lus10009629 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.