Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51590 59 / 5e-12 LTP12 lipid transfer protein 12 (.1) AT5G59320 57 / 3e-11 LTP3 lipid transfer protein 3 (.1) AT5G59310 56 / 6e-11 LTP4 lipid transfer protein 4 (.1) AT2G18370 56 / 2e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G01870 54 / 6e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 54 / 6e-10 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G08770 53 / 8e-10 LTP6 lipid transfer protein 6 (.1.2) AT2G38530 52 / 2e-09 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT4G33355 50 / 1e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G38540 50 / 2e-08 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009003 [exp] 215 / 3e-73 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1) Lus10042512 [exp] 88 / 2e-23 AT2G18370 64 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10031282 [exp] 85 / 4e-22 AT4G33355 56 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10039270 [exp] 84 / 3e-21 AT5G59310 69 / 4e-16 lipid transfer protein 4 (.1) Lus10031851 [exp] 84 / 1e-20 AT5G58510 109 / 2e-27 unknown protein Lus10025151 [exp] 67 / 6e-15 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10022745 [exp] 67 / 7e-15 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10025231 [exp] 66 / 2e-14 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10014167 [exp] 63 / 2e-13 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G046500 [exp] 58 / 1e-11 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.016G135700 [exp] 54 / 7e-10 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.016G135400 [exp] 53 / 1e-09 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.009G025200 [exp] 52 / 3e-09 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 51 / 5e-09 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086600 [exp] 50 / 1e-08 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232700 [exp] 50 / 2e-08 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 49 / 3e-08 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G136000 [exp] 49 / 4e-08 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G108100 [exp] 47 / 2e-07 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10009630 pacid=23140102 polypeptide=Lus10009630 locus=Lus10009630.g ID=Lus10009630.BGIv1.0 annot-version=v1.0 ATGAAGAACACATCCTCAGTCGCGATCTTCATCACCCTGTTGGCGATTATCGTCGCAGCGGCCGATGCATCGGTGCAATGCAGCTACGTGTCCAAGCACG CAAAGCCGTGTCTCAATTACGCTACGGGGGTGGCGAGCAATGTGGCGCCGGAGTGCTGCAACGGGCTGAAGAGGCTCGTCCGCAACGCGACTTCGGGGGG AGACAAGAAGGACGTGTGTGAGTGCTTCGACAAGGCTTTCAAGCATTTCCCGTTAGTGCAGAACGAGAACTTGGATGCCATTGTCAAGGTCTGCAAGGTT AATGTTCCTTTCAAGCTCTCCAAGAACCCCGACTGCAACAATATGTATATATTTCAGCATCAACTAGCTAGTGCATGGGAGCATAGGATATTTGCAGTGA AGCCTTCGATCGCCGCAAGCCTTCGTTGCCGCCATGGTGGTCTATGA
AA sequence Show only first row Show all	>Lus10009630 pacid=23140102 polypeptide=Lus10009630 locus=Lus10009630.g ID=Lus10009630.BGIv1.0 annot-version=v1.0 MKNTSSVAIFITLLAIIVAAADASVQCSYVSKHAKPCLNYATGVASNVAPECCNGLKRLVRNATSGGDKKDVCECFDKAFKHFPLVQNENLDAIVKVCKV NVPFKLSKNPDCNNMYIFQHQLASAWEHRIFAVKPSIAASLRCRHGGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10009630 [exp]	0	1
					Lus10011605 [exp]	4.0	1.0000
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Lus10000677 [exp]	4.7	1.0000
					Lus10025268 [exp]	4.9	1.0000
AT4G30380		EXLB2	Barwin-related endoglucanase (...		Lus10026232 [exp]	5.3	1.0000
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	6.6	1.0000
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	8.1	1.0000
AT4G32690		ATGLB3, GLB3	ARABIDOPSIS HEMOGLOBIN 3, hemo...		Lus10007678 [exp]	9.2	1.0000
					Lus10018141 [exp]	9.6	1.0000
					Lus10020128 [exp]	10.2	1.0000
AT3G47570			Leucine-rich repeat protein ki...		Lus10020546 [exp]	10.4	1.0000

Compare expression of checked genes

Lus10009630 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.