Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G15300 73 / 4e-16 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G16610 65 / 3e-13 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G69350 64 / 4e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G13410 62 / 2e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G32430 61 / 5e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G29230 61 / 6e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G39680 61 / 6e-12 EMB2744 EMBRYO DEFECTIVE 2744, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G58590 61 / 8e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G25060 61 / 8e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G04840 59 / 2e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010169 [exp] 186 / 2e-56 AT3G09040 357 / 4e-109 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028647 [exp] 66 / 2e-13 AT1G43980 459 / 4e-156 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009702 [exp] 66 / 2e-13 AT5G27110 409 / 1e-134 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10018945 [exp] 64 / 7e-13 AT1G21400 644 / 0.0 Thiamin diphosphate-binding fold (THDP-binding) superfamily protein (.1) Lus10013540 [exp] 63 / 1e-12 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039117 [exp] 62 / 2e-12 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038741 [exp] 62 / 3e-12 AT3G24000 739 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10036029 [exp] 62 / 3e-12 AT5G27110 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009269 [exp] 62 / 5e-12 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G027400 [exp] 102 / 2e-26 AT4G13650 408 / 8e-128 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G245200 [exp] 69 / 9e-15 AT3G25060 683 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G085800 [exp] 68 / 2e-14 AT4G02750 491 / 3e-164 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G185300 [exp] 68 / 3e-14 AT1G43980 635 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G245300 [exp] 66 / 1e-13 AT3G22690 570 / 0.0 unknown protein Potri.012G140400 [exp] 63 / 1e-12 AT3G29230 398 / 2e-132 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G321700 [exp] 63 / 1e-12 AT4G14050 808 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G021700 [exp] 62 / 2e-12 AT3G47840 796 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G125500 [exp] 62 / 3e-12 AT3G29230 829 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G067500 [exp] 61 / 5e-12 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009637 pacid=23140072 polypeptide=Lus10009637 locus=Lus10009637.g ID=Lus10009637.BGIv1.0 annot-version=v1.0 ATGCAGTGTCTGGGACTAAAATTCGACATATATACCTTCATCAGCTCTCTTCACGGAAGCTCAATTGCGTTTGATTTGGATTTCGGGAAGCAGCTTCATG GATTGATTCTCAGAATTGGAGAAGAAGCATTGTGCAGTACTTCTGTCATGAATGCTCTTATGGACATGTACACGAAGAACGGCGTAATAGACTGTGCTAT GGAAGTATTTAGAGTAACGGTTCATAGGGATATTGTGACATGGAATACTGCGTTACAGAGTTCAAGAGAAGTCATTAACCTATTCCGGGATTTTATGTTG ACCGATTTATGTCCGAATCGCATCACATTCTCGTCGTTATTCATGTGA
AA sequence Show only first row Show all	>Lus10009637 pacid=23140072 polypeptide=Lus10009637 locus=Lus10009637.g ID=Lus10009637.BGIv1.0 annot-version=v1.0 MQCLGLKFDIYTFISSLHGSSIAFDLDFGKQLHGLILRIGEEALCSTSVMNALMDMYTKNGVIDCAMEVFRVTVHRDIVTWNTALQSSREVINLFRDFML TDLCPNRITFSSLFM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G69350			Tetratricopeptide repeat (TPR)...		Lus10009637 [exp]	0	1
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Lus10033676 [exp]	13.6	0.6785
AT4G16835			Tetratricopeptide repeat (TPR)...		Lus10010998 [exp]	16.1	0.6528
AT5G45420	MYB	maMYB	membrane anchored MYB, Duplica...		Lus10036429 [exp]	23.0	0.6552
AT1G13410			Tetratricopeptide repeat (TPR)...		Lus10017243 [exp]	23.7	0.6635
AT3G59980			Nucleic acid-binding, OB-fold-...		Lus10025611 [exp]	29.5	0.6283
AT1G05750		PDE247, CLB19	pigment defective 247, Tetratr...		Lus10001853 [exp]	48.2	0.5940
AT3G05640			Protein phosphatase 2C family ...		Lus10020671 [exp]	51.7	0.6185
AT3G01820			P-loop containing nucleoside t...		Lus10032057 [exp]	60.3	0.5811
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10025979 [exp]	97.5	0.5743
AT3G46790		CRR2	CHLORORESPIRATORY REDUCTION 2,...		Lus10001557 [exp]	107.7	0.5646

Compare expression of checked genes

Lus10009637 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.