Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G32500 54 / 3e-10 ABCI7, ATNAP6 ATP-binding cassette I7, non-intrinsic ABC protein 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010168 [exp] 87 / 8e-22 AT1G32500 550 / 0.0 ATP-binding cassette I7, non-intrinsic ABC protein 6 (.1) Lus10017374 [exp] 85 / 3e-21 AT1G32500 550 / 0.0 ATP-binding cassette I7, non-intrinsic ABC protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G089700 [exp] 66 / 3e-14 AT1G32500 544 / 0.0 ATP-binding cassette I7, non-intrinsic ABC protein 6 (.1) Potri.001G144500 [exp] 65 / 4e-14 AT1G32500 535 / 0.0 ATP-binding cassette I7, non-intrinsic ABC protein 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009638 pacid=23140054 polypeptide=Lus10009638 locus=Lus10009638.g ID=Lus10009638.BGIv1.0 annot-version=v1.0 ATGGGGTTTTCGTGGGCAGTTTGTGTGAAATCTCAGAAAAGGTTGCGTCTTTCTTTGATGAGTGATTTCCAGTATGGTGATTTGTTCTTGTCCATTAATG GGTTGGGAACACCGGATGTTGCTGTGGGTTTTGTTCCATCTGGGGTTAGAGTAGAGACTCTTATCCATTTGAAGTATTTGTCTGTTCAAGGTGGATCCTT GAGGTGGTGA
AA sequence Show only first row Show all	>Lus10009638 pacid=23140054 polypeptide=Lus10009638 locus=Lus10009638.g ID=Lus10009638.BGIv1.0 annot-version=v1.0 MGFSWAVCVKSQKRLRLSLMSDFQYGDLFLSINGLGTPDVAVGFVPSGVRVETLIHLKYLSVQGGSLRW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G32500		ABCI7, ATNAP6	ATP-binding cassette I7, non-i...		Lus10009638 [exp]	0	1
					Lus10022017 [exp]	2.8	0.9312
AT1G18260		HRD3A, EBS5	EMS-mutagenized bri1 suppresso...		Lus10009047 [exp]	2.8	0.9215
AT3G47160			RING/U-box superfamily protein...		Lus10001209 [exp]	6.7	0.9183
AT1G50575			Putative lysine decarboxylase ...		Lus10003762 [exp]	7.3	0.9115
AT4G03115			Mitochondrial substrate carrie...		Lus10024769 [exp]	8.5	0.9137
AT2G42130			Plastid-lipid associated prote...		Lus10016263 [exp]	13.3	0.9042
AT2G32415			Polynucleotidyl transferase, r...		Lus10031563 [exp]	14.3	0.8792
AT1G15200			protein-protein interaction re...		Lus10023800 [exp]	16.9	0.9086
AT1G30140			unknown protein		Lus10024751 [exp]	17.3	0.9123
AT4G08690			Sec14p-like phosphatidylinosit...		Lus10020911 [exp]	18.5	0.8919

Compare expression of checked genes

Lus10009638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.