Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74000 51 / 1e-08 SS3 strictosidine synthase 3 (.1) AT1G74010 44 / 2e-06 Calcium-dependent phosphotriesterase superfamily protein (.1) AT1G74020 41 / 3e-05 SS2 strictosidine synthase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009014 [exp] 171 / 1e-51 AT1G74020 201 / 8e-59 strictosidine synthase 2 (.1) Lus10009650 [exp] 116 / 6e-33 AT1G74010 156 / 3e-44 Calcium-dependent phosphotriesterase superfamily protein (.1) Lus10009649 [exp] 115 / 2e-32 AT1G74020 155 / 6e-44 strictosidine synthase 2 (.1) Lus10009015 [exp] 102 / 1e-26 AT3G57030 190 / 6e-54 Calcium-dependent phosphotriesterase superfamily protein (.1) Lus10009648 [exp] 94 / 3e-24 AT3G57030 192 / 4e-58 Calcium-dependent phosphotriesterase superfamily protein (.1) Lus10009646 [exp] 71 / 1e-15 AT1G74020 207 / 7e-63 strictosidine synthase 2 (.1) Lus10009651 [exp] 50 / 2e-08 AT3G57030 163 / 2e-48 Calcium-dependent phosphotriesterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G037700 [exp] 61 / 2e-12 AT1G74000 218 / 7e-69 strictosidine synthase 3 (.1) Potri.012G046200 [exp] 49 / 3e-08 AT1G74000 206 / 2e-64 strictosidine synthase 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009647 pacid=23140073 polypeptide=Lus10009647 locus=Lus10009647.g ID=Lus10009647.BGIv1.0 annot-version=v1.0 ATGGCCAACACGTCGGAGCCGTTCATAACGAACATTGTCCCGCCAGTGAGCATTAGGCGGACTGTAGAAGGAGAATTCTCGATTGCGGCCGGCATGGTGG ATCTGGCATCACGGTCGTCGGTACCGATGGCGGTGAGGGCGGATACTACCGGGAGGGTAGTCGAAACGACGTTGCTTTTCGAGCAGTTTGGGGACCTTAT CGTGACCGAAGTGAACCGGCCTTCGATGAATATGACGACTTATATAAGCTCCTCGTACGCTCCTTACATTATGGTTTATGAAGGTCCTATATGA
AA sequence Show only first row Show all	>Lus10009647 pacid=23140073 polypeptide=Lus10009647 locus=Lus10009647.g ID=Lus10009647.BGIv1.0 annot-version=v1.0 MANTSEPFITNIVPPVSIRRTVEGEFSIAAGMVDLASRSSVPMAVRADTTGRVVETTLLFEQFGDLIVTEVNRPSMNMTTYISSSYAPYIMVYEGPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74000		SS3	strictosidine synthase 3 (.1)		Lus10009647 [exp]	0	1

Compare expression of checked genes

Lus10009647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.