Lus10009653 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16720 334 / 3e-118 Ribosomal protein L23/L15e family protein (.1)
AT4G17390 333 / 7e-118 Ribosomal protein L23/L15e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009017 363 / 7e-130 AT4G16720 343 / 1e-121 Ribosomal protein L23/L15e family protein (.1)
Lus10004743 360 / 3e-128 AT4G16720 345 / 1e-122 Ribosomal protein L23/L15e family protein (.1)
Lus10007805 360 / 3e-128 AT4G16720 345 / 1e-122 Ribosomal protein L23/L15e family protein (.1)
Lus10000165 358 / 3e-127 AT4G16720 344 / 2e-121 Ribosomal protein L23/L15e family protein (.1)
Lus10028965 358 / 5e-127 AT4G16720 343 / 5e-121 Ribosomal protein L23/L15e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G141500 350 / 1e-124 AT4G16720 331 / 4e-117 Ribosomal protein L23/L15e family protein (.1)
Potri.014G057300 350 / 1e-124 AT4G16720 331 / 4e-117 Ribosomal protein L23/L15e family protein (.1)
Potri.013G106800 347 / 2e-123 AT4G16720 333 / 1e-117 Ribosomal protein L23/L15e family protein (.1)
Potri.003G078700 347 / 2e-123 AT4G16720 333 / 1e-117 Ribosomal protein L23/L15e family protein (.1)
Potri.001G156100 346 / 4e-123 AT4G16720 330 / 2e-116 Ribosomal protein L23/L15e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0652 S24e_L23_L15e PF00827 Ribosomal_L15e Ribosomal L15
Representative CDS sequence
>Lus10009653 pacid=23140024 polypeptide=Lus10009653 locus=Lus10009653.g ID=Lus10009653.BGIv1.0 annot-version=v1.0
ATGGGGGCGTACAAGTACGTGTCGGAGCTATGGAGGAAGAAGCAGTCGGACGTGATGAGGTTTCTGCAGAGGGTAAGGTGCTGGGAGTATCGCCAGCATC
CTTCGATCGTCCGAGTTACTCACCCTACTCGCCCTGACAAGGCTCGCCGCTTGGGCTACAAGGCTAAGCAGGGTTACGTAGTTTATCGAGTGCGTGTGAG
GCGAGGTGGAAGGAAGAGGCCAGTGCCGAAGGGTATTGTCTACGGTAAACCAACCAACCAGGGAGTCACCCAGCTGAAATTCCAGCGTAGCAAGCGATCG
GTTGCGGAGGAGCGTGCTGGGAGGAAGCTAGCTGGACTTAAGGTTCTCAACTCATACTGGCTCAACGAGGATTCGACGTACAAGTACTTTGAGGTGATCC
TGGTTGATGCTGCTCACAATGCCATCCGAAACGACCCGAGGATCAACTGGATCTGCAACCCGGTCCACAAGCACAGGGAGCTTCGCGGTCTTACCTCTGC
AGGGAAGAAGTACAGAGGTCTCCGAGGGAAAGGGTCTCGGTTCCACAAGAACAAGCCGTCGAGGAGGGCTACTTGGAAGAGGAACAACACGCTGTCGCTT
CGCCGATACCGTTCATAA
AA sequence
>Lus10009653 pacid=23140024 polypeptide=Lus10009653 locus=Lus10009653.g ID=Lus10009653.BGIv1.0 annot-version=v1.0
MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTHPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRS
VAEERAGRKLAGLKVLNSYWLNEDSTYKYFEVILVDAAHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGSRFHKNKPSRRATWKRNNTLSL
RRYRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16720 Ribosomal protein L23/L15e fam... Lus10009653 0 1
AT1G64350 SEH1H Transducin/WD40 repeat-like su... Lus10001904 2.2 0.8873
AT1G77580 Plant protein of unknown funct... Lus10042719 2.8 0.8899
AT2G20635 ATP binding;protein kinases;pr... Lus10033673 3.2 0.8983
AT3G61620 RRP41 3'-5'-exoribonuclease family p... Lus10000255 4.2 0.8634
AT1G76120 Pseudouridine synthase family ... Lus10021231 6.2 0.8677
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10041029 7.7 0.8823
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10010745 9.2 0.8704
AT4G37630 CYCD5;1 cyclin d5;1 (.1.2) Lus10018688 9.6 0.8598
AT1G77580 Plant protein of unknown funct... Lus10029679 10.2 0.8883
AT3G07170 Sterile alpha motif (SAM) doma... Lus10025917 12.6 0.8636

Lus10009653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.