Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04620 64 / 1e-12 BIO4, ATBIOF biotin 4, biotin F (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009024 [exp] 135 / 9e-39 AT5G04620 667 / 0.0 biotin 4, biotin F (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G126700 [exp] 69 / 1e-14 AT5G04620 607 / 0.0 biotin 4, biotin F (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009662 pacid=23140074 polypeptide=Lus10009662 locus=Lus10009662.g ID=Lus10009662.BGIv1.0 annot-version=v1.0 ATGGAAGAGGTCGGCCAGCTGATCGAACCGACCGGGTCTGATTTGACTCGGGTTAGCTGCTCTGGAAACTTGGGCGTAAAGGACGATGAAAGCCTTTTCT GCACGATTTACTGCTCTTCACGGATTCCCTCCAACAGCTCCTGGGACGAAAGGCTGGACGAGGCAATCTCCAAGCTCGAGTCCACTAAGCTCCTCCGTTC GTTGAGACCTATTACCCTCAACAAGCAACGCCCTCCCTGTTCTTCATCACCAGTACTCGACCATGGCTACAAGGTGTTCGACGAAATGCAGCAATGGGAT CGGTCCTCCGTCGAAGTCTCCGTTTCCGATTCCACTTTCCACAGCTGGCTCCGTAATGCCGCCAGTGTTGGTGAGTTTTAA
AA sequence Show only first row Show all	>Lus10009662 pacid=23140074 polypeptide=Lus10009662 locus=Lus10009662.g ID=Lus10009662.BGIv1.0 annot-version=v1.0 MEEVGQLIEPTGSDLTRVSCSGNLGVKDDESLFCTIYCSSRIPSNSSWDERLDEAISKLESTKLLRSLRPITLNKQRPPCSSSPVLDHGYKVFDEMQQWD RSSVEVSVSDSTFHSWLRNAASVGEF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04620		BIO4, ATBIOF	biotin 4, biotin F (.1.2)		Lus10009662 [exp]	0	1
					Lus10033476 [exp]	3.2	0.8752
AT3G27050			unknown protein		Lus10032042 [exp]	3.5	0.8511
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10026046 [exp]	5.1	0.8683
AT1G62340		ALE1	ABNORMAL LEAF-SHAPE 1, ABNORMA...		Lus10015559 [exp]	6.7	0.8366
AT4G35980			unknown protein		Lus10042598 [exp]	7.4	0.8268
AT3G05370		AtRLP31	receptor like protein 31 (.1)		Lus10019692 [exp]	9.2	0.8406
AT3G52420		ATOEP7	outer envelope membrane protei...		Lus10003733 [exp]	10.0	0.8444
AT1G79840	HD	GL2	GLABRA 2, HD-ZIP IV family of ...		Lus10011440 [exp]	10.6	0.8396
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Lus10024973 [exp]	10.6	0.8124
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Lus10016115 [exp]	11.0	0.7999

Compare expression of checked genes

Lus10009662 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.