Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73860 181 / 1e-51 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G18410 165 / 4e-46 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G63640 149 / 1e-40 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) AT5G41310 144 / 1e-38 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT3G44730 126 / 1e-32 AtKIN14h, ATKP1 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) AT2G47500 120 / 9e-31 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT1G09170 116 / 3e-29 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT5G27000 109 / 6e-27 KATD, ATK4 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) AT3G10310 101 / 5e-24 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) AT1G72250 88 / 1e-19 Di-glucose binding protein with Kinesin motor domain (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031783 [exp] 287 / 2e-93 AT1G73860 269 / 4e-79 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10009028 [exp] 241 / 2e-72 AT1G63640 351 / 5e-103 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10002007 [exp] 165 / 5e-46 AT1G63640 941 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10032264 [exp] 159 / 5e-44 AT1G63640 991 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10024628 [exp] 159 / 6e-44 AT1G63640 980 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Lus10032897 [exp] 123 / 2e-31 AT3G44730 1302 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Lus10001306 [exp] 121 / 6e-31 AT3G44730 1240 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Lus10029865 [exp] 119 / 4e-30 AT5G27000 1014 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1) Lus10009851 [exp] 117 / 2e-29 AT2G47500 1245 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G047400 [exp] 163 / 1e-45 AT1G63640 908 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.001G104000 [exp] 162 / 6e-45 AT1G63640 1102 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.012G056700 [exp] 155 / 9e-43 AT1G63640 857 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.003G127800 [exp] 152 / 1e-41 AT1G63640 1065 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1), P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.2) Potri.011G165200 [exp] 127 / 6e-33 AT3G44730 1300 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Potri.001G467600 [exp] 124 / 7e-32 AT3G44730 1266 / 0.0 ARABIDOPSIS KINESIN-LIKE PROTEIN 1, kinesin-like protein 1 (.1) Potri.002G201000 [exp] 120 / 1e-30 AT2G47500 1237 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.014G125700 [exp] 119 / 5e-30 AT2G47500 1218 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.005G021100 [exp] 115 / 5e-29 AT2G47500 1051 / 0.0 P-loop nucleoside triphosphate hydrolases superfamily protein with CH (Calponin Homology) domain (.1) Potri.013G011500 [exp] 110 / 3e-27 AT5G27000 1081 / 0.0 KINESIN-LIKE PROTEIN IN ARABIDOPSIS THALIANA D, kinesin 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00225 [flax] [poplar] Kinesin Kinesin motor domain
Representative CDS sequence Show only first row Show all	>Lus10009668 pacid=23140027 polypeptide=Lus10009668 locus=Lus10009668.g ID=Lus10009668.BGIv1.0 annot-version=v1.0 ATGCTCCCCGTGTTCACCACATCCGACGTAATGGACCTAATGCAGATCGGCCTCAACAATAGGGCGGTGAGCTCCACCGCCAAGAACGAGAGGAGCAGTC GGGCCCACAGCGGCCTGAGCGTCTTGGGCGACGTCATTTTCGCCCTTGCTCAGAAGTCTACTCATGTTCCTTATAGGAACAGTAAACTCACTCAGCTGCT TCAAAGCTCTTTAGGCGGACAAGCAAAAACACTAATGTTCGTACAGCTGAACCCAGACGCCACCTCCTACTCGGAAAGCCTCAGCACGCTGAAATTCGAG CTCGGAGCAGCGAAGAGCAACCCGGGGAGGGACGTCAAGGAGCTAATGGAGCAGCTTGCATCACTCAAGGACACCATCGCCAACAAGGACGAGGAGATCG AGAGGCTACAAGTGCTCAAAGCCGGCGCCGCACACCCGCAGCAGGGGAGGCTGCGGACGCGGCGGTCGGTGGAGAAGGATTCGGAGATGGGTGGTGGCGA TTCGGAGAGTAGGTATAGTGATAATTATATGTCGGACGGGGAAGCTTCGGTCGGGACTGAGCCGGAGTCCGTACATGACGACGGAGGCGGAGGAGGAGGG AGAGCTTCGTCGGCAGATAAGCGTACGGGGCCGAAAGGGTTGACTAAGGCGAGGAGCTTGCAGAGGCTGACGGAGACTAGGCCGTCGACGACGGTTACGG TGTCGAGAGACCACCTCAAAGGATCAACAAGTGTTAAGAAAGCTACTGCCGGCAGCAGCACCTCCACCTCGCAAAAGCCGACGAGTGCCAGCAGATCACG GCGAGCATAA
AA sequence Show only first row Show all	>Lus10009668 pacid=23140027 polypeptide=Lus10009668 locus=Lus10009668.g ID=Lus10009668.BGIv1.0 annot-version=v1.0 MLPVFTTSDVMDLMQIGLNNRAVSSTAKNERSSRAHSGLSVLGDVIFALAQKSTHVPYRNSKLTQLLQSSLGGQAKTLMFVQLNPDATSYSESLSTLKFE LGAAKSNPGRDVKELMEQLASLKDTIANKDEEIERLQVLKAGAAHPQQGRLRTRRSVEKDSEMGGGDSESRYSDNYMSDGEASVGTEPESVHDDGGGGGG RASSADKRTGPKGLTKARSLQRLTETRPSTTVTVSRDHLKGSTSVKKATAGSSTSTSQKPTSASRSRRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73860			P-loop containing nucleoside t...		Lus10009668 [exp]	0	1

Compare expression of checked genes

Lus10009668 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.