Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12300 62 / 8e-13 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT5G55530 57 / 3e-11 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) AT1G50570 53 / 6e-10 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036036 [exp] 89 / 1e-22 AT5G12300 192 / 9e-58 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10001346 [exp] 59 / 3e-12 AT5G12300 72 / 9e-15 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10032578 [exp] 59 / 1e-11 AT5G55530 395 / 2e-136 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) Lus10003765 [exp] 56 / 1e-10 AT5G55530 451 / 1e-157 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) Lus10016592 [exp] 55 / 1e-10 AT5G55530 152 / 5e-43 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G070400 [exp] 68 / 3e-15 AT5G12300 283 / 2e-92 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.001G275800 [exp] 63 / 2e-13 AT5G12300 285 / 7e-93 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.011G088400 [exp] 55 / 2e-10 AT5G55530 418 / 9e-145 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) Potri.001G361100 [exp] 54 / 3e-10 AT5G55530 431 / 2e-149 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009693 pacid=23160105 polypeptide=Lus10009693 locus=Lus10009693.g ID=Lus10009693.BGIv1.0 annot-version=v1.0 ATGTACATGAGGAGTATGCAGCAGTTTACTGAGTCGCTTGCTAAAATGAAGCTTCCGATGGATTTTGACAAACCCGGAGGAGGAGGAGATTTGATTCAAG CAATTCATGGGAATAGTGGTAATGATCATAAGCAGGAGGATGAAATTGATGAGCACCAACAACAGCAGCAGAAGAAGAAAAAGGATGGATCAAGGGTGTT TTATGGGAGCCGAGCCTTCTTCTAG
AA sequence Show only first row Show all	>Lus10009693 pacid=23160105 polypeptide=Lus10009693 locus=Lus10009693.g ID=Lus10009693.BGIv1.0 annot-version=v1.0 MYMRSMQQFTESLAKMKLPMDFDKPGGGGDLIQAIHGNSGNDHKQEDEIDEHQQQQQKKKKDGSRVFYGSRAFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12300			Calcium-dependent lipid-bindin...		Lus10009693 [exp]	0	1
AT3G27880			Protein of unknown function (D...		Lus10032145 [exp]	1.7	0.9241
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Lus10035011 [exp]	5.9	0.9308
AT4G28270		ATRMA2	RING membrane-anchor 2 (.1)		Lus10031641 [exp]	7.3	0.9144
AT2G37040		PAL1, ATPAL1	PHE ammonia lyase 1 (.1)		Lus10040416 [exp]	8.4	0.9278
AT1G48780			unknown protein		Lus10009004 [exp]	10.1	0.9003
AT1G51680		AT4CL1, 4CL.1, ...	ARABIDOPSIS THALIANA 4-COUMARA...		Lus10026143 [exp]	13.9	0.9150
AT1G23390			Kelch repeat-containing F-box ...		Lus10029128 [exp]	14.1	0.8946
AT1G23390			Kelch repeat-containing F-box ...		Lus10029127 [exp]	14.1	0.8892
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10026097 [exp]	15.7	0.9204
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10002321 [exp]	15.9	0.9232

Compare expression of checked genes

Lus10009693 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.