Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000331 [exp] 111 / 4e-30 AT5G36930 217 / 1e-57 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004726 [exp] 75 / 2e-17 AT5G36930 167 / 5e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004719 [exp] 73 / 1e-16 AT5G36930 384 / 3e-113 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007790 [exp] 73 / 1e-16 AT5G36930 343 / 4e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005179 [exp] 72 / 1e-16 AT3G44670 44 / 2e-04 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10008516 [exp] 72 / 2e-16 AT4G27220 59 / 1e-08 NB-ARC domain-containing disease resistance protein (.1) Lus10002249 [exp] 71 / 7e-16 AT5G36930 286 / 2e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10002248 [exp] 70 / 9e-16 AT5G40060 42 / 0.001 Disease resistance protein (NBS-LRR class) family (.1) Lus10007811 [exp] 69 / 3e-15 AT5G36930 376 / 1e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009699 pacid=23160104 polypeptide=Lus10009699 locus=Lus10009699.g ID=Lus10009699.BGIv1.0 annot-version=v1.0 ATGGGAGCTATTGTGGTGGACTATAAGACACCTACAGGTTTAAAGGAGTTGTACACTTCATCCCGGATTTTGAATCTCGCAGACATGTCCGAGTTGGAGG TGTTGGAAGTTGAGGATTGTAAGCATGGACTCGACATCCCTTCCCTATGGTGGAAGGTTTCCAAGTTGAATACTTTATCGCTCACACAAACAAAGATCAA CGATGACACTGCTGGTAGTAACCATCGTTGGTGA
AA sequence Show only first row Show all	>Lus10009699 pacid=23160104 polypeptide=Lus10009699 locus=Lus10009699.g ID=Lus10009699.BGIv1.0 annot-version=v1.0 MGAIVVDYKTPTGLKELYTSSRILNLADMSELEVLEVEDCKHGLDIPSLWWKVSKLNTLSLTQTKINDDTAGSNHRW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009699 [exp]	0	1
AT3G48200			unknown protein		Lus10002461 [exp]	2.2	0.9604
AT2G24960			unknown protein		Lus10042421 [exp]	3.0	0.9695
AT3G28540			P-loop containing nucleoside t...		Lus10007270 [exp]	3.7	0.9656
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10020330 [exp]	6.6	0.9611
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	6.7	0.9621
AT3G58880			F-box/RNI-like superfamily pro...		Lus10020329 [exp]	7.3	0.9450
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10026811 [exp]	10.6	0.9545
					Lus10010828 [exp]	11.0	0.9001
AT3G07360		ATPUB9	ARABIDOPSIS THALIANA PLANT U-B...		Lus10024776 [exp]	11.4	0.8890
AT5G05340			Peroxidase superfamily protein...		Lus10030149 [exp]	11.8	0.9442

Compare expression of checked genes

Lus10009699 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.