Lus10009704 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G30520 150 / 4e-43 AAE14 acyl-activating enzyme 14 (.1)
AT4G19010 52 / 3e-08 AMP-dependent synthetase and ligase family protein (.1)
AT3G48990 49 / 5e-07 AMP-dependent synthetase and ligase family protein (.1)
AT1G20510 48 / 9e-07 OPCL1 OPC-8:0 CoA ligase1 (.1.2)
AT1G20480 48 / 1e-06 AMP-dependent synthetase and ligase family protein (.1)
AT4G05160 47 / 1e-06 AMP-dependent synthetase and ligase family protein (.1)
AT3G16170 47 / 2e-06 AAE13 acyl activating enzyme 13, AMP-dependent synthetase and ligase family protein (.1)
AT3G21230 47 / 3e-06 4CL5 4-coumarate:CoA ligase 5 (.1)
AT3G21240 46 / 4e-06 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1)
AT1G21530 45 / 6e-06 AMP-dependent synthetase and ligase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036027 289 / 2e-98 AT1G30520 436 / 3e-150 acyl-activating enzyme 14 (.1)
Lus10035861 54 / 1e-08 AT3G16170 643 / 0.0 acyl activating enzyme 13, AMP-dependent synthetase and ligase family protein (.1)
Lus10027477 52 / 1e-08 AT3G48990 355 / 2e-122 AMP-dependent synthetase and ligase family protein (.1)
Lus10039232 51 / 1e-07 AT3G48990 840 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10013773 50 / 1e-07 AT5G16370 422 / 1e-146 acyl activating enzyme 5 (.1)
Lus10039161 49 / 8e-07 AT5G16370 781 / 0.0 acyl activating enzyme 5 (.1)
Lus10015998 48 / 1e-06 AT1G20510 833 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Lus10021431 47 / 2e-06 AT4G05160 803 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Lus10012280 47 / 2e-06 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G164100 178 / 2e-53 AT1G30520 645 / 0.0 acyl-activating enzyme 14 (.1)
Potri.006G169700 54 / 1e-08 AT3G21240 802 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.001G105900 52 / 6e-08 AT3G48990 750 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.015G144700 51 / 1e-07 AT3G48990 776 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.001G055700 50 / 1e-07 AT1G62940 786 / 0.0 acyl-CoA synthetase 5 (.1)
Potri.003G099700 49 / 4e-07 AT4G19010 634 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.018G094200 47 / 1e-06 AT3G21240 807 / 0.0 4-coumarate:CoA ligase 2 (.1)
Potri.004G102000 47 / 2e-06 AT4G05160 826 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Potri.008G031500 47 / 3e-06 AT1G20510 466 / 3e-159 OPC-8:0 CoA ligase1 (.1.2)
Potri.001G185500 47 / 3e-06 AT3G16170 705 / 0.0 acyl activating enzyme 13, AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0378 ANL PF00501 AMP-binding AMP-binding enzyme
Representative CDS sequence
>Lus10009704 pacid=23160095 polypeptide=Lus10009704 locus=Lus10009704.g ID=Lus10009704.BGIv1.0 annot-version=v1.0
ATGCAGATATCCGGGGAGACGGAACCACAAGGTGTCTGCGTTGGCAACCCCGCTCCACATGTCGAGTTAAGTGTACGTCAGTGTGGCTCCTCCGCGAGTG
GAACAATTTTAACCAGAGGCCCTCACGTTATGATGGGATATTGGGATCAATACACTTCCAAGGAATTGCATTCTACCAACGATGTTTGGCTTGACACTAG
AGACGTTGGTTCCATTGATCAAAGTGGCAATCTGTGGCTCCTTGGACGCATGAATGATCGAATAAAGAGTGGTGGTGAGAATGTTTACCCTACCGAGGAA
CCCCACCATAAAGATATAGAGGCCGTCCTCTTACAGCATCCGGGAGTTATCCGTGTCGTGGTTGTGGGAATTCCGGATGTTCGGTTGGGAGAGCAGGTCG
TTGGTTGTATTCAATTACGAGAAAGCTGGCAATGGTCCGATCACTGTTGTGCAGGACAGGGTGAAAGTAAGGAAGAGATATGTAGCGAGGCTTTGAAGAA
GCAATGCAGAGCAAAGAATTTAACTGGGTAA
AA sequence
>Lus10009704 pacid=23160095 polypeptide=Lus10009704 locus=Lus10009704.g ID=Lus10009704.BGIv1.0 annot-version=v1.0
MQISGETEPQGVCVGNPAPHVELSVRQCGSSASGTILTRGPHVMMGYWDQYTSKELHSTNDVWLDTRDVGSIDQSGNLWLLGRMNDRIKSGGENVYPTEE
PHHKDIEAVLLQHPGVIRVVVVGIPDVRLGEQVVGCIQLRESWQWSDHCCAGQGESKEEICSEALKKQCRAKNLTG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G30520 AAE14 acyl-activating enzyme 14 (.1) Lus10009704 0 1
Lus10027391 1.7 0.8272
AT4G34180 Cyclase family protein (.1) Lus10031454 2.8 0.7953
AT1G21350 Thioredoxin superfamily protei... Lus10018916 8.5 0.7927
Lus10008296 11.1 0.7494
AT3G13180 NOL1/NOP2/sun family protein /... Lus10022523 12.2 0.7948
AT3G18440 ATALMT9 aluminum-activated malate tran... Lus10041471 19.1 0.7510
AT5G19500 Tryptophan/tyrosine permease (... Lus10036099 21.2 0.7925
AT2G45910 U-box domain-containing protei... Lus10014771 21.7 0.7871
AT5G02250 ATMTRNASEII, RN... ribonucleotide reductase 1, EM... Lus10010842 22.8 0.7756
AT5G19120 Eukaryotic aspartyl protease f... Lus10041004 24.5 0.6703

Lus10009704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.