Plant FIBer expression Database

Lus10009707 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G12390 74 / 2e-18 FIS1B FISSION 1B, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G57090 74 / 2e-18 FIS1A, BIGYIN FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009706
[exp]
102 / 2e-29 AT3G57090 237 / 6e-81 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036023
[exp]
88 / 3e-23 AT3G57090 223 / 1e-74 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G038900
[exp]
82 / 1e-21 AT3G57090 216 / 1e-72 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G041900
[exp]
78 / 4e-20 AT3G57090 215 / 2e-72 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G047300
[exp]
76 / 6e-19 AT3G57090 203 / 9e-68 FISSION 1A, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10009707 pacid=23160111 polypeptide=Lus10009707 locus=Lus10009707.g ID=Lus10009707.BGIv1.0 annot-version=v1.0
ATGCGTTTATCATGGGCTCTGGTTCACTCGAAGCAACCAGAAGATGTTCAACGCGGCATAGCTATGCTTGAATATGTGTTGGCCGCACTTACAGCTTCCT
CCACCAGCCCTTTGAAACAGAGAGAGAAACTGTATCTTCTGGCTATTGGGTACTTCAGGAGCAGTGAGTACTCGAGGAGCAGGGAGGTGGTGGAAGAATG
TTCACCACTATAA
AA sequence
>Lus10009707 pacid=23160111 polypeptide=Lus10009707 locus=Lus10009707.g ID=Lus10009707.BGIv1.0 annot-version=v1.0
MRLSWALVHSKQPEDVQRGIAMLEYVLAALTASSTSPLKQREKLYLLAIGYFRSSEYSRSREVVEECSPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G12390 FIS1B FISSION 1B, Tetratricopeptide ... Lus10009707
[exp]
0 1
Lus10010248
[exp]
1.0 0.8648
AT2G48020 Major facilitator superfamily ... Lus10042676
[exp]
2.4 0.7630
AT1G06640 2-oxoglutarate (2OG) and Fe(II... Lus10013314
[exp]
2.8 0.7960
AT2G30130 AS2 PCK1, LBD12, AS... PEACOCK 1, Lateral organ bound... Lus10005284
[exp]
4.5 0.7573
Lus10031263
[exp]
6.6 0.6696
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Lus10028845
[exp]
8.8 0.7009
AT4G08180 ORP1C OSBP(oxysterol binding protein... Lus10025695
[exp]
11.5 0.7609
AT1G25275 unknown protein Lus10004192
[exp]
15.3 0.6879
AT5G27750 F-box/FBD-like domains contain... Lus10004848
[exp]
16.2 0.6015
AT4G24040 TREHALASE1, ATT... trehalase 1 (.1) Lus10032434
[exp]
17.0 0.6942

Lus10009707 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.