Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015034 [exp] 76 / 9e-19 ND / Lus10033006 [exp] 63 / 3e-15 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009719 pacid=23173073 polypeptide=Lus10009719 locus=Lus10009719.g ID=Lus10009719.BGIv1.0 annot-version=v1.0 ATGACCCGGCCTCCCCTGGCTCTTCCACCGTCCGGGCTCCCCTTCCTCCCTATGCTCCCCCGGCGCAGGCCTACCACGCTTCGCGCCTGCGGCGTTTTCG CCAGACGGTCTTTGCCAGTAGTGCCATCCTCCCCGCTGGCTGTATGGGCGGGTTGTCCCTCGATGCTGCGTTCTGTTAGGCTATAG
AA sequence Show only first row Show all	>Lus10009719 pacid=23173073 polypeptide=Lus10009719 locus=Lus10009719.g ID=Lus10009719.BGIv1.0 annot-version=v1.0 MTRPPLALPPSGLPFLPMLPRRRPTTLRACGVFARRSLPVVPSSPLAVWAGCPSMLRSVRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009719 [exp]	0	1
AT5G26330			Cupredoxin superfamily protein...		Lus10006680 [exp]	7.7	0.9992
					Lus10007416 [exp]	9.0	0.9789
AT5G64820			unknown protein		Lus10025572 [exp]	11.0	0.9992
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10000794 [exp]	12.9	0.9768
AT4G36670		AtPMT6, AtPLT6	polyol/monosaccharide transpor...		Lus10017474 [exp]	13.4	0.9992
AT1G12980	AP2_ERF	DRN, ESR1	ENHANCER OF SHOOT REGENERATION...		Lus10014345 [exp]	14.0	0.9960
					Lus10038707 [exp]	15.5	0.9992
AT5G02030	HD	PNY, BLR, BLH9,...	VAAMANA, REPLUMLESS, PENNYWISE...		Lus10004688 [exp]	16.5	0.9929
AT2G23810		TET8	tetraspanin8 (.1)		Lus10027256 [exp]	17.3	0.9992
AT1G18720			Protein of unknown function (D...		Lus10021660 [exp]	19.0	0.9992

Compare expression of checked genes

Lus10009719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.