Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000527 [exp] 117 / 1e-35 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G194100 [exp] 70 / 5e-17 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10009731 pacid=23145162 polypeptide=Lus10009731 locus=Lus10009731.g ID=Lus10009731.BGIv1.0 annot-version=v1.0 ATGTCTGTTAACAAGCAGAGGAGCCTCTCTATCCACAGTGCCAAACGCATGAGGTTTGGCAAGTGGTTTTCCTTCAAGGAGGTGCAGATGGAACCTGGCA AGTCGTTGAAACAGCAGAATTCTGGGAAGTTGAAAGCTGATATCAAGAGATGGGCGAAAGCCGTGGCAGCTTATGCCCGCCAACTCAGTGGCCGGCTTGG AACTTCAATCAGGAGCAGCAGGATCAGAAGAAGCTCCTCCTCCCATTCTTCTACTTCTTCTTCATCGCCACAATCATCATCGACGGTATCAGTATGA
AA sequence Show only first row Show all	>Lus10009731 pacid=23145162 polypeptide=Lus10009731 locus=Lus10009731.g ID=Lus10009731.BGIv1.0 annot-version=v1.0 MSVNKQRSLSIHSAKRMRFGKWFSFKEVQMEPGKSLKQQNSGKLKADIKRWAKAVAAYARQLSGRLGTSIRSSRIRRSSSSHSSTSSSSPQSSSTVSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10009731 [exp]	0	1
AT3G48280		CYP71A25	"cytochrome P450, family 71, s...		Lus10041951 [exp]	2.4	0.9691
AT2G23770			protein kinase family protein ...		Lus10018788 [exp]	2.6	0.9736
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10022756 [exp]	5.5	0.9715
AT5G13190		AtGILP	GSH-induced LITAF domain prote...		Lus10001805 [exp]	7.9	0.9590
AT4G34350		HDR, CLB6, ISPH	CHLOROPLAST BIOGENESIS 6, 4-hy...		Lus10011310 [exp]	9.5	0.9703
AT1G09090		ATRBOHB-BETA, A...	respiratory burst oxidase homo...		Lus10029896 [exp]	10.5	0.9710
					Lus10000527 [exp]	11.1	0.9704
AT3G50930		BCS1	cytochrome BC1 synthesis (.1)		Lus10025989 [exp]	11.4	0.9610
AT5G65380			MATE efflux family protein (.1...		Lus10012741 [exp]	11.5	0.9625
AT3G52710			unknown protein		Lus10017030 [exp]	16.6	0.9573

Compare expression of checked genes

Lus10009731 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.