Lus10009733 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08860 52 / 4e-08 BON3 BONZAI 3, Calcium-dependent phospholipid-binding Copine family protein (.1)
AT5G61900 45 / 1e-05 CPN1, BON1 COPINE 1, BONZAI 1, Calcium-dependent phospholipid-binding Copine family protein (.1.3)
AT5G61910 45 / 1e-05 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3), DCD (Development and Cell Death) domain protein (.4)
AT5G07300 44 / 4e-05 BON2 BONZAI 2, Calcium-dependent phospholipid-binding Copine family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018973 57 / 1e-09 AT1G08860 403 / 4e-137 BONZAI 3, Calcium-dependent phospholipid-binding Copine family protein (.1)
Lus10033826 55 / 7e-09 AT1G08860 880 / 0.0 BONZAI 3, Calcium-dependent phospholipid-binding Copine family protein (.1)
Lus10043206 44 / 4e-05 AT5G61900 684 / 0.0 COPINE 1, BONZAI 1, Calcium-dependent phospholipid-binding Copine family protein (.1.3)
Lus10032533 44 / 5e-05 AT5G61910 387 / 6e-131 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3), DCD (Development and Cell Death) domain protein (.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G029100 49 / 8e-07 AT1G08860 857 / 0.0 BONZAI 3, Calcium-dependent phospholipid-binding Copine family protein (.1)
Potri.012G108200 47 / 4e-06 AT5G61910 827 / 0.0 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3), DCD (Development and Cell Death) domain protein (.4)
Potri.015G106400 45 / 1e-05 AT5G61910 796 / 0.0 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3), DCD (Development and Cell Death) domain protein (.4)
PFAM info
Representative CDS sequence
>Lus10009733 pacid=23145166 polypeptide=Lus10009733 locus=Lus10009733.g ID=Lus10009733.BGIv1.0 annot-version=v1.0
ATGGTGGTGCGCGATAAGGAAAAGGAGAAGACGGGGTGGGAGGCGGGTTTCAGCGGCATGGGTAGGAGGTGGGGTCTGTGGTGTTGGAAGGGCCATATAG
GGGAGGTAACACAGTTCTATGATTCAAAGAAGCGCTTCCCATCTTGGTGTTTCGGAGGGAGGACACCAGATGGTGAAGTATATGGCATTTCATGGAACTC
CAATTGGCTAGGAGGTGATTTTGCCTTACTGAATCATATGGCATTGCAACCTCTATATATCACAGAGCAATCTGTGCGTACCTTCATGGATCATGCGATT
CAGTCTTATTGCGAGAATAATCAGATTGATATTGATGGTGATTGTGACAAAGGAGACGGTTCTGCTGTCGAAAAGAAGAAGGCTAAACTAGCCAAGGGTG
TTCATTCAAAGCAAGCTAGAAAACGTGGGAATGTTGGTGTTTCTGCCAAAAAATCAGCGGAGGATCAGAGTGTTAATACTACAGGTATTGATGCTAAGAT
TAAGGTTCATTTTTCTCCTCCGTGGAAAATGCAGAAGGCTACACTTCCATCACCTGATATTGTGTTGTCCAAAATTTAA
AA sequence
>Lus10009733 pacid=23145166 polypeptide=Lus10009733 locus=Lus10009733.g ID=Lus10009733.BGIv1.0 annot-version=v1.0
MVVRDKEKEKTGWEAGFSGMGRRWGLWCWKGHIGEVTQFYDSKKRFPSWCFGGRTPDGEVYGISWNSNWLGGDFALLNHMALQPLYITEQSVRTFMDHAI
QSYCENNQIDIDGDCDKGDGSAVEKKKAKLAKGVHSKQARKRGNVGVSAKKSAEDQSVNTTGIDAKIKVHFSPPWKMQKATLPSPDIVLSKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08860 BON3 BONZAI 3, Calcium-dependent ph... Lus10009733 0 1

Lus10009733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.