Lus10009747 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47200 97 / 8e-26 WPP2 WPP domain protein 2 (.1)
AT5G43070 94 / 5e-25 WPP1 WPP domain protein 1 (.1)
AT5G27940 52 / 9e-09 WPP3 WPP domain protein 3 (.1)
AT3G63130 48 / 5e-07 ATRANGAP1, RANGAP1 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
AT5G19320 44 / 2e-05 RANGAP2 RAN GTPase activating protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010235 187 / 1e-61 AT1G47200 124 / 2e-36 WPP domain protein 2 (.1)
Lus10042643 124 / 8e-37 AT1G47200 125 / 4e-37 WPP domain protein 2 (.1)
Lus10010523 51 / 6e-08 AT5G19320 666 / 0.0 RAN GTPase activating protein 2 (.1)
Lus10034066 51 / 7e-08 AT5G19320 669 / 0.0 RAN GTPase activating protein 2 (.1)
Lus10014670 46 / 3e-06 AT3G63130 717 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Lus10006930 46 / 3e-06 AT3G63130 712 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G021900 115 / 7e-33 AT1G47200 115 / 1e-32 WPP domain protein 2 (.1)
Potri.002G122000 106 / 1e-29 AT1G47200 111 / 1e-31 WPP domain protein 2 (.1)
Potri.010G091100 53 / 1e-08 AT5G19320 646 / 0.0 RAN GTPase activating protein 2 (.1)
Potri.005G209600 47 / 2e-06 AT3G63130 667 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
Potri.002G052900 44 / 1e-05 AT3G63130 664 / 0.0 RAN GTPASE-ACTIVATING PROTEIN 1, RAN GTPase activating protein 1 (.1.2)
PFAM info
Representative CDS sequence
>Lus10009747 pacid=23178322 polypeptide=Lus10009747 locus=Lus10009747.g ID=Lus10009747.BGIv1.0 annot-version=v1.0
ATGTCTGACTCCGATGTAACTGCCGCCGTTCCATCGGCAGATCCTATCGTATCACCGCCGGAAGAGAAGCCGACGCCTGCTAGAGTACCGAAGGCTCTCA
ACATTTGGCCTCCTTCCCAGCGCACTCGCGACGCCGTCGTTTCTCGCTTAATCGAGACCTTATCTACTCCTTCCGTACTCTCCAAGCGCTACGGAACGCT
TCCCCAGGAAGAGGCCTCTGAAGCCGCTCGCCGAATCGAGGAGGAAGCCTTTAGCGCCTCCAACGACTCTGCTTCTACCGAGGACGAGGGCCTCGAGATC
CTCCAGCGTTATTCTAAGGCGATCAGCAAGCGAATGCTGAATACCGTCAAGGCTCACTCCGCTACTGCTACTGCGACCGATAATATTTCTCCGGAGACGC
CCCCTGTTGATGTTCTTCCTGCTGAATCTGCTCCTGAAGAAGTTCCGGCTTCTGAAAAGGCTCGAGCTTGA
AA sequence
>Lus10009747 pacid=23178322 polypeptide=Lus10009747 locus=Lus10009747.g ID=Lus10009747.BGIv1.0 annot-version=v1.0
MSDSDVTAAVPSADPIVSPPEEKPTPARVPKALNIWPPSQRTRDAVVSRLIETLSTPSVLSKRYGTLPQEEASEAARRIEEEAFSASNDSASTEDEGLEI
LQRYSKAISKRMLNTVKAHSATATATDNISPETPPVDVLPAESAPEEVPASEKARA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47200 WPP2 WPP domain protein 2 (.1) Lus10009747 0 1
AT1G07090 LSH6 LIGHT SENSITIVE HYPOCOTYLS 6, ... Lus10022023 1.4 0.9176
AT3G19330 Protein of unknown function (D... Lus10031977 2.2 0.8738
AT5G28490 OBO2, LSH1 ORGAN BOUNDARY 2, LIGHT-DEPEND... Lus10042565 3.5 0.8974
AT1G47200 WPP2 WPP domain protein 2 (.1) Lus10010235 4.2 0.9160
AT3G55700 UDP-Glycosyltransferase superf... Lus10004671 4.6 0.8723
AT2G48010 RKF3 receptor-like kinase in in flo... Lus10042679 6.0 0.8724
AT1G69910 Protein kinase superfamily pro... Lus10036691 6.0 0.8673
AT4G23740 Leucine-rich repeat protein ki... Lus10032351 6.6 0.8776
AT4G19550 zinc ion binding;transcription... Lus10006630 6.7 0.8427
AT3G51850 CPK13 calcium-dependent protein kina... Lus10002482 9.5 0.8394

Lus10009747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.