Lus10009751 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16260 47 / 2e-06 Wall-associated kinase family protein (.1.2)
AT1G21270 47 / 4e-06 WAK2 wall-associated kinase 2 (.1)
AT1G16090 46 / 4e-06 WAKL7 wall associated kinase-like 7 (.1)
AT1G16160 46 / 7e-06 WAKL5 wall associated kinase-like 5 (.1)
AT1G21250 44 / 3e-05 PRO25, WAK1 cell wall-associated kinase (.1)
AT1G16130 44 / 3e-05 WAKL2 wall associated kinase-like 2 (.1)
AT1G17910 43 / 5e-05 Wall-associated kinase family protein (.1)
AT1G21240 42 / 0.0001 WAK3 wall associated kinase 3 (.1)
AT1G21210 42 / 0.0001 WAK4 wall associated kinase 4 (.1)
AT1G79670 40 / 0.0009 WAKL22, RFO1 RESISTANCE TO FUSARIUM OXYSPORUM 1, Wall-associated kinase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013383 235 / 2e-73 AT1G21270 427 / 4e-139 wall-associated kinase 2 (.1)
Lus10013385 140 / 1e-38 AT1G21270 437 / 2e-143 wall-associated kinase 2 (.1)
Lus10013384 135 / 9e-37 AT1G21270 430 / 3e-140 wall-associated kinase 2 (.1)
Lus10008434 122 / 2e-32 AT5G04885 796 / 0.0 Glycosyl hydrolase family protein (.1)
Lus10038077 64 / 5e-12 AT1G21270 576 / 0.0 wall-associated kinase 2 (.1)
Lus10034085 57 / 2e-09 AT1G16130 526 / 5e-179 wall associated kinase-like 2 (.1)
Lus10003063 49 / 8e-07 AT1G16130 514 / 2e-173 wall associated kinase-like 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G192500 105 / 3e-26 AT1G16260 525 / 2e-177 Wall-associated kinase family protein (.1.2)
Potri.009G154600 103 / 6e-26 AT1G21270 447 / 2e-147 wall-associated kinase 2 (.1)
Potri.004G192900 102 / 2e-25 AT1G21270 458 / 1e-151 wall-associated kinase 2 (.1)
Potri.004G192400 102 / 2e-25 AT1G21270 466 / 2e-154 wall-associated kinase 2 (.1)
Potri.009G154100 101 / 3e-25 AT1G21270 437 / 2e-143 wall-associated kinase 2 (.1)
Potri.004G192700 101 / 6e-25 AT1G21270 464 / 4e-154 wall-associated kinase 2 (.1)
Potri.004G192000 100 / 6e-25 AT1G21270 379 / 2e-121 wall-associated kinase 2 (.1)
Potri.009G154500 97 / 9e-25 AT1G21270 98 / 5e-23 wall-associated kinase 2 (.1)
Potri.004G191450 100 / 1e-24 AT1G21270 474 / 7e-158 wall-associated kinase 2 (.1)
Potri.009G157201 99 / 2e-24 AT1G16260 500 / 4e-167 Wall-associated kinase family protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10009751 pacid=23178325 polypeptide=Lus10009751 locus=Lus10009751.g ID=Lus10009751.BGIv1.0 annot-version=v1.0
ATGCAGATATCCGCAATTCTTCTCCTCCTTCTTCAATTAAGATTCATCTCTTCCGCCGACGTAATCTCCGACGACTGCTCCGACAAATGCGGCAACGTCA
CTGTGTCGTACCCTTACGGAATCGGCGATCCCAAGTGCACAATCTCCTCCTCCTTCCTCTTCACCTGCAACTCCTCTGCCGGCGAGCCTCAACTGGTGTT
CGGCCGTAACATCGCCGTACAGAACATCTCAATCGAAGAAGGAACCTTCTCCGACATCATGCTCGCCGCTTACCGCTGCTACAACGAGACCGGATCCATG
GACTGTTTCCGGTTCAACCCGGCGATCACGCTCGGATCAGGGCCGTTTCGGTTCTCCAACGTGTACAACAAGCTCACTGCCTTCGGGTGCGACACTCTGG
CATTCATGACCGACTCCCAAAAGCACTTTCGGCAGCGGGCTGCGTCTCCCTCTGCGACGACGTTTCCGCCGCCGTCAACATCTCCGCCGCCTCGAGGAAG
AACTCCGATATCTGCTCCGGAATCGGCTGCTGCCAGAGCTCGATTCCTCTTGGATTGA
AA sequence
>Lus10009751 pacid=23178325 polypeptide=Lus10009751 locus=Lus10009751.g ID=Lus10009751.BGIv1.0 annot-version=v1.0
MQISAILLLLLQLRFISSADVISDDCSDKCGNVTVSYPYGIGDPKCTISSSFLFTCNSSAGEPQLVFGRNIAVQNISIEEGTFSDIMLAAYRCYNETGSM
DCFRFNPAITLGSGPFRFSNVYNKLTAFGCDTLAFMTDSQKHFRQRAASPSATTFPPPSTSPPPRGRTPISAPESAAARARFLLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G16260 Wall-associated kinase family ... Lus10009751 0 1
Lus10038412 2.0 0.8355
AT1G61440 S-locus lectin protein kinase ... Lus10038413 4.5 0.7938
AT1G74250 DNAJ heat shock N-terminal dom... Lus10012524 8.1 0.8025
AT3G47570 Leucine-rich repeat protein ki... Lus10030634 12.5 0.8180
AT2G06040 unknown protein Lus10017169 21.4 0.7758
AT2G23200 Protein kinase superfamily pro... Lus10012646 26.9 0.7620
Lus10000834 28.1 0.7549
AT1G45160 Protein kinase superfamily pro... Lus10005470 28.8 0.7695
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10027322 29.8 0.7028
AT3G15270 SBP SPL5 squamosa promoter binding prot... Lus10005548 33.0 0.7591

Lus10009751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.