Lus10009759 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33350 339 / 1e-117 AtTic22-IV translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
AT3G23710 137 / 4e-38 AtTic22-III translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006487 480 / 3e-173 AT4G33350 358 / 2e-125 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Lus10022378 146 / 9e-42 AT3G23710 305 / 2e-103 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Lus10007784 127 / 5e-35 AT3G23710 257 / 2e-85 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G126800 369 / 1e-129 AT4G33350 374 / 7e-132 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.014G030000 367 / 1e-128 AT4G33350 359 / 5e-126 translocon at the inner envelope membrane of chloroplasts 22-IV, Tic22-like family protein (.1.2)
Potri.002G236000 152 / 4e-44 AT3G23710 351 / 7e-122 translocon at the inner envelope membrane of chloroplasts 22-III, Tic22-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04278 Tic22 Tic22-like family
Representative CDS sequence
>Lus10009759 pacid=23178320 polypeptide=Lus10009759 locus=Lus10009759.g ID=Lus10009759.BGIv1.0 annot-version=v1.0
ATGGAGCCCTTTAAACCCTCAAACCCTCTCTTATCTTTCTCCTCCTTCCTCCACCAACAATGCCTCCGCATAGGCTCCGATTTCTCCACTCGCCTCGGCG
ACACCACTCGAGCCCTATCCACCTCCTTCCCCTCAGCAAGTGCCAGGAGGCTCCACCTTCCACCGCCGCCGCTATTCGCCTCCGTTTCTCAGGCGAAACC
GTCATCCCCAAGGCTTAGCTCCGATTACGTGGCTAAGAGACTCACTGGCACGACCGTCTACACGGTGAGCAACACCAACAACGAGTTCGTCCTCATTTCT
GATCCTGATGGAGCTAAGTCCATCGGATTGCTCTGCTTCCGCAAGGAAGATGCTGAAGCTTTTCTGTCTCAGGTGCGATTACGGAGAAATGAATTACGAA
GTTCGGCCAAGGTAGTGCCTATTACACTTGAGCAGGTCTACATGCTGAAGGTTGAAGGCATTGCATTCAGGTTCTTGCCAGATCCTGTCCAAATAAAGAA
CGCATTGGAGATGAAAACTTCCAGCACAAGAAGTGGGTTCGATGGAGTTCCTGTATTCCAGTCAGAACTTCTGGCGGTGAAGAAGAAAAACAGGCGTTTC
TGCCCTATATACTTCCAAAAGGAGGACATAGATAAAGAATTGGCCAAGGTTTCAAGAGGGAGAGCCATTTCTCCTAATATAATGGGATCAAAGAAATTTG
TAGCAGCTGTTTTGAGAGATGTCAAGGGAGAGAATAAGCTGAGTATTGAAAGTAGAGATGTGGGGAGCTTGGAAGATGTGCTGAGAAAAATTGAGACGAG
TGAGAAAAACTCGGGTTGGGAAGATTTGATATTCATTCCACCTGGTAAAACTCAGTCCGAACACATTAATGACATAACCAAGTGA
AA sequence
>Lus10009759 pacid=23178320 polypeptide=Lus10009759 locus=Lus10009759.g ID=Lus10009759.BGIv1.0 annot-version=v1.0
MEPFKPSNPLLSFSSFLHQQCLRIGSDFSTRLGDTTRALSTSFPSASARRLHLPPPPLFASVSQAKPSSPRLSSDYVAKRLTGTTVYTVSNTNNEFVLIS
DPDGAKSIGLLCFRKEDAEAFLSQVRLRRNELRSSAKVVPITLEQVYMLKVEGIAFRFLPDPVQIKNALEMKTSSTRSGFDGVPVFQSELLAVKKKNRRF
CPIYFQKEDIDKELAKVSRGRAISPNIMGSKKFVAAVLRDVKGENKLSIESRDVGSLEDVLRKIETSEKNSGWEDLIFIPPGKTQSEHINDITK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33350 AtTic22-IV translocon at the inner envelo... Lus10009759 0 1
AT3G06950 Pseudouridine synthase family ... Lus10039480 2.0 0.7937
AT1G48570 zinc finger (Ran-binding) fami... Lus10009049 8.2 0.7974
AT4G11160 Translation initiation factor ... Lus10033933 19.1 0.7717
AT1G72040 P-loop containing nucleoside t... Lus10016950 21.3 0.7787
AT2G45030 Translation elongation factor ... Lus10018604 23.3 0.7660
AT2G40510 Ribosomal protein S26e family ... Lus10030533 25.2 0.7761
AT1G63660 GMP synthase (glutamine-hydrol... Lus10024632 31.7 0.7739
AT5G18820 Cpn60alpha2, EM... embryo defective 3007, chapero... Lus10036216 32.9 0.7439
AT3G52750 FTSZ2-2 Tubulin/FtsZ family protein (.... Lus10014196 36.0 0.7541
AT1G11750 NCLPP6, NCLPP1,... NUCLEAR-ENCODED CLPP 1, CLP pr... Lus10011282 36.5 0.7590

Lus10009759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.